BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001229-TA|BGIBMGA001229-PA|undefined (66 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B1.03c |kap95||karyopherin Kap95|Schizosaccharomyces pombe|... 23 6.6 SPBC1685.05 |||serine protease |Schizosaccharomyces pombe|chr 2|... 22 8.7 >SPAC1B1.03c |kap95||karyopherin Kap95|Schizosaccharomyces pombe|chr 1|||Manual Length = 863 Score = 22.6 bits (46), Expect = 6.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Query: 1 MTCASEVFALEYQLWWRSSTVRSLAAVEMLA 31 +T E LEYQ W+S V V+ LA Sbjct: 65 ITAREEARKLEYQQLWQSLPVEIKQQVKSLA 95 >SPBC1685.05 |||serine protease |Schizosaccharomyces pombe|chr 2|||Manual Length = 997 Score = 22.2 bits (45), Expect = 8.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Query: 3 CASEVFALEYQLWWRSSTVRSLAAVEMLAAPSPR 36 C + QL + +TVRS++ VE + PR Sbjct: 642 CTLAALDEDLQLLTKKTTVRSVSVVETERSSPPR 675 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.326 0.131 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 250,601 Number of Sequences: 5004 Number of extensions: 6025 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 66 length of database: 2,362,478 effective HSP length: 46 effective length of query: 20 effective length of database: 2,132,294 effective search space: 42645880 effective search space used: 42645880 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -