BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001229-TA|BGIBMGA001229-PA|undefined (66 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23063| Best HMM Match : TPR_1 (HMM E-Value=3.1e-07) 25 6.5 SB_14989| Best HMM Match : UPF0181 (HMM E-Value=0.11) 25 6.5 >SB_23063| Best HMM Match : TPR_1 (HMM E-Value=3.1e-07) Length = 374 Score = 25.4 bits (53), Expect = 6.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 20 TVRSLAAVEMLAAPSPRTVRLQGFGIWDFSVELKR 54 TVR+ A V + S R L GFG++ + + LK+ Sbjct: 106 TVRNKALVPLRIELSKRHKELDGFGLYLYGLVLKK 140 >SB_14989| Best HMM Match : UPF0181 (HMM E-Value=0.11) Length = 446 Score = 25.4 bits (53), Expect = 6.5 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Query: 10 LEYQLWWRSSTVRS---LAAVEMLAAPSPRTV 38 +E LWWR+ST+ L+ +E+L SP TV Sbjct: 81 VELVLWWRTSTLYLFLWLSLMELLEDLSPVTV 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.326 0.131 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,834,943 Number of Sequences: 59808 Number of extensions: 41506 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 111 Number of HSP's gapped (non-prelim): 2 length of query: 66 length of database: 16,821,457 effective HSP length: 45 effective length of query: 21 effective length of database: 14,130,097 effective search space: 296732037 effective search space used: 296732037 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -