BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001227-TA|BGIBMGA001227-PA|undefined (212 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.34 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 1.8 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 2.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.6 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.4 bits (53), Expect = 0.34 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 7 GTSNKKELLDEIVNRNKLG-NKKSHSETSLQQYGENDDVFTIDAGQDPGVLNA 58 G+S+ L ++ ++ + N ++HS TS N + +AG PG + A Sbjct: 986 GSSHPLAALQKLCDKTETHTNNRTHSATSNSSVNANTNNIPTNAGTTPGAILA 1038 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 125 GDSGTATPTGERGSPLPYNG 144 G G + P G G+PL + G Sbjct: 220 GSMGVSVPCGTSGNPLEWTG 239 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 2.4 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 8/80 (10%) Query: 11 KKELLDEIVNR--NKLGNKKSHSETSLQQYGENDDVFTIDAGQDPG----VLNASLTNLQ 64 KKE+ +EI + +K S + + Y DDV I+ G+ PG L + L+ ++ Sbjct: 214 KKEVKEEIEDEPDHKWKKNDSSKKKTRYYYRSVDDV--IEKGKRPGAFRTTLGSELSKVK 271 Query: 65 NADDNPNRKRTMSQPGPVSG 84 D ++R +S +SG Sbjct: 272 VIDMTGPQQRVLSGYHALSG 291 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 187 SIRSVETHAPPPTNP 201 S S+E +APPP P Sbjct: 722 SYLSMENNAPPPPPP 736 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.6 Identities = 10/39 (25%), Positives = 18/39 (46%) Query: 39 GENDDVFTIDAGQDPGVLNASLTNLQNADDNPNRKRTMS 77 GEN +F +D V T+ N + RK++++ Sbjct: 1382 GENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFRKKSLA 1420 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.6 Identities = 10/39 (25%), Positives = 18/39 (46%) Query: 39 GENDDVFTIDAGQDPGVLNASLTNLQNADDNPNRKRTMS 77 GEN +F +D V T+ N + RK++++ Sbjct: 1382 GENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFRKKSLA 1420 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.303 0.125 0.346 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,568 Number of Sequences: 317 Number of extensions: 2300 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 212 length of database: 114,650 effective HSP length: 54 effective length of query: 158 effective length of database: 97,532 effective search space: 15410056 effective search space used: 15410056 T: 11 A: 40 X1: 16 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.0 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -