BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001226-TA|BGIBMGA001226-PA|IPR005829|Sugar transporter superfamily, IPR011701|Major facilitator superfamily MFS_1 (846 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 26 0.93 DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 25 2.8 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 3.8 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 26.2 bits (55), Expect = 0.93 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 1 MCTHQSDGDINVVFDSVLNQEV 22 MCTHQ D +N + + VL EV Sbjct: 567 MCTHQVDIPLNAIVEVVLVDEV 588 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 24.6 bits (51), Expect = 2.8 Identities = 15/46 (32%), Positives = 20/46 (43%) Query: 93 NRYANSTDNVGVDLSPNAEDVCPVYLFDRSTIIPCDNYVHERTNTV 138 N+Y N DNV VD N + V Y+ PC + E T+ Sbjct: 21 NKYTNKYDNVDVDKILNNDRVLTNYIKCLMDEGPCTSEGRELKKTL 66 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 24.2 bits (50), Expect = 3.8 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 97 NSTDNVGVDLSPNAEDVCPVYLFDRSTIIPCDNYVHE 133 N T+NV V S N+ DVC S +I +Y H+ Sbjct: 104 NFTNNVLVHRSQNSNDVC--LAIPESLVIKLVDYHHQ 138 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,115 Number of Sequences: 317 Number of extensions: 8345 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 3 length of query: 846 length of database: 114,650 effective HSP length: 63 effective length of query: 783 effective length of database: 94,679 effective search space: 74133657 effective search space used: 74133657 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -