BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001224-TA|BGIBMGA001224-PA|IPR006875|Sarcoglycan complex subunit protein (325 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0433 - 3402250-3402536,3402644-3403030,3403523-3403957,340... 31 0.95 >12_01_0433 - 3402250-3402536,3402644-3403030,3403523-3403957, 3404071-3404562,3404718-3404821,3404913-3404994, 3405085-3405441,3405532-3406089,3406376-3406479, 3406575-3406650,3406764-3406898,3407192-3407494, 3407581-3408345,3409459-3412591,3412763-3412882 Length = 2445 Score = 31.5 bits (68), Expect = 0.95 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 5/86 (5%) Query: 131 SIESTRNFSVSTRDAQGLLQSRLFLGHDRLELNVGRFEVRDSRGALLL----GAGQDSVT 186 SI + N S + DA+GL ++ + H+ + ++ VR A L G G+D + Sbjct: 430 SISESNNVSRAQTDAKGLKTAQPLM-HNAAKTSMKNVVVRKDENAGLTKRKTGRGRDKIA 488 Query: 187 IGADTLTVSSSAGVTLNTAVQTSLVK 212 +++S S+G L T +Q +++ Sbjct: 489 KSVGKVSLSESSGEALPTEMQQEVIE 514 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,599,834 Number of Sequences: 37544 Number of extensions: 306952 Number of successful extensions: 633 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 632 Number of HSP's gapped (non-prelim): 3 length of query: 325 length of database: 14,793,348 effective HSP length: 82 effective length of query: 243 effective length of database: 11,714,740 effective search space: 2846681820 effective search space used: 2846681820 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -