BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001221-TA|BGIBMGA001221-PA|IPR008530|Protein of unknown function DUF812 (135 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 1.5 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 3.5 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 4.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 4.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 4.6 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 4.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 4.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 4.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 4.6 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 6.1 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.6 bits (46), Expect = 1.5 Identities = 9/21 (42%), Positives = 11/21 (52%) Query: 53 YKNDVGYQTFLYYNEAELRQV 73 Y ND Y LYYN + Q+ Sbjct: 96 YNNDNNYNKKLYYNINYIEQI 116 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 3.5 Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 73 VFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEE 112 V + IE+ NE K+ + S++ N++ + S++ S E Sbjct: 184 VLVVNIEKSENESKKYATSSNSLRNRTHGFQHTSSRYSRE 223 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 4.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 110 SEEMEKIWVPHCCKPNEQQ 128 SE ++ IWVP NE+Q Sbjct: 87 SEFIKNIWVPDTFFVNEKQ 105 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 4.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 110 SEEMEKIWVPHCCKPNEQQ 128 SE ++ IWVP NE+Q Sbjct: 87 SEFIKNIWVPDTFFVNEKQ 105 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 4.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 73 VFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEE 112 V + IE+ NE K+ + S++ N++ + S++ S E Sbjct: 195 VLVVNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRE 234 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 4.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 73 VFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEE 112 V + IE+ NE K+ + S++ N++ + S++ S E Sbjct: 200 VLVVNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRE 239 Score = 20.6 bits (41), Expect = 6.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 53 YKNDVGYQTFLYYNEAELRQV 73 Y N+ Y LYYN + Q+ Sbjct: 334 YNNNNNYNKKLYYNINYIEQI 354 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 4.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 73 VFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEE 112 V + IE+ NE K+ + S++ N++ + S++ S E Sbjct: 195 VLVVNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRE 234 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 4.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 73 VFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEE 112 V + IE+ NE K+ + S++ N++ + S++ S E Sbjct: 195 VLVVNIEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRE 234 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.0 bits (42), Expect = 4.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 110 SEEMEKIWVPHCCKPNEQQ 128 SE ++ IWVP NE+Q Sbjct: 26 SEFIKNIWVPDTFFVNEKQ 44 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.6 bits (41), Expect = 6.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 53 YKNDVGYQTFLYYNEAELRQV 73 Y N+ Y LYYN + Q+ Sbjct: 96 YNNNNNYNKKLYYNINYIEQI 116 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.130 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,537 Number of Sequences: 429 Number of extensions: 1197 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 135 length of database: 140,377 effective HSP length: 52 effective length of query: 83 effective length of database: 118,069 effective search space: 9799727 effective search space used: 9799727 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -