BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001221-TA|BGIBMGA001221-PA|IPR008530|Protein of unknown function DUF812 (135 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55830.1 68414.m06402 expressed protein similar to M-type 9 p... 45 2e-05 At1g22460.1 68414.m02807 expressed protein similar to axi 1 [Nic... 29 0.82 At5g37220.1 68418.m04470 zinc finger (C3HC4-type RING finger) fa... 28 2.5 At5g11330.1 68418.m01323 monooxygenase family protein low simila... 28 2.5 At3g20960.1 68416.m02649 cytochrome P450 family protein similar ... 27 3.3 At5g13600.1 68418.m01574 phototropic-responsive NPH3 family prot... 27 4.4 At4g37100.1 68417.m05255 hypothetical protein 27 5.8 At4g30230.1 68417.m04299 hypothetical protein 27 5.8 At3g09080.1 68416.m01067 transducin family protein / WD-40 repea... 27 5.8 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 27 5.8 At5g55530.3 68418.m06918 C2 domain-containing protein low simila... 26 7.6 At5g55530.2 68418.m06917 C2 domain-containing protein low simila... 26 7.6 At5g55530.1 68418.m06916 C2 domain-containing protein low simila... 26 7.6 At5g45650.1 68418.m05613 subtilase family protein contains Pfam ... 26 7.6 At5g08600.1 68418.m01023 U3 ribonucleoprotein (Utp) family prote... 26 7.6 At4g37080.2 68417.m05252 expressed protein contains Pfam profile... 26 7.6 At4g37080.1 68417.m05253 expressed protein contains Pfam profile... 26 7.6 At4g35270.1 68417.m05012 RWP-RK domain-containing protein simila... 26 7.6 At3g47660.1 68416.m05188 regulator of chromosome condensation (R... 26 7.6 >At1g55830.1 68414.m06402 expressed protein similar to M-type 9 protein (GI:507127) [Streptococcus pyogenes] Length = 509 Score = 45.2 bits (102), Expect = 2e-05 Identities = 35/147 (23%), Positives = 69/147 (46%), Gaps = 21/147 (14%) Query: 7 EFIIEAASKCLNAINPSLKVPQKLPKGISHRIEVAAQIASFCKDLGYKNDVGYQT----- 61 E ++ ++ LN I+PS +LP + R + IA K+LGY ND+ Y Sbjct: 33 EALVSICAQLLNLIDPSASFSDELPDSLPERFRICTDIAHSVKNLGYINDMSYYKEQAFI 92 Query: 62 -----------FLYYNEAELRQVFMFLIERLP--NEGKQSSVSASLKTN-QSTLMKDVSN 107 FL+ +E + ++ FL+ERL +EG+++ + + + + +D+S+ Sbjct: 93 VPESCDSPLVFFLHPSEDDSYRLVRFLVERLSEISEGRKTLTAGDIASRPKMETFRDISD 152 Query: 108 --KISEEMEKIWVPHCCKPNEQQKGIT 132 ++E+ ++ + H K K +T Sbjct: 153 DMMVNEDKDETFDMHIQKVEAVLKDLT 179 >At1g22460.1 68414.m02807 expressed protein similar to axi 1 [Nicotiana tabacum] GI:559921; contains Pfam profile PF03138: Plant protein family Length = 565 Score = 29.5 bits (63), Expect = 0.82 Identities = 13/41 (31%), Positives = 24/41 (58%) Query: 17 LNAINPSLKVPQKLPKGISHRIEVAAQIASFCKDLGYKNDV 57 +NA++ ++V +KLPKGI +V S+ Y+N++ Sbjct: 220 INALSKDIRVIKKLPKGIDGLTKVVKHFKSYSGLSYYQNEI 260 >At5g37220.1 68418.m04470 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 214 Score = 27.9 bits (59), Expect = 2.5 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 6/85 (7%) Query: 31 PKGISHRIEVAAQIASFCKDLGYKNDVGYQTFLYYNEAELRQVF-MFLIERLPNEGKQSS 89 P ISH ++ + FC+DLG K + + Y + L +F MF++ L E + Sbjct: 68 PLYISHLLQQSISHTRFCQDLGEK--IAHNC-AYLSGLPL--IFEMFVVVELTQEVLITL 122 Query: 90 VSASLKTNQSTLMKDVSNKISEEME 114 SAS+ DV ++ EE + Sbjct: 123 PSASVAVPSKAASSDVLQRLVEEQK 147 >At5g11330.1 68418.m01323 monooxygenase family protein low similarity to 2,6-dihydroxypyridine 3-hydroxylase (DHPH) [GI:14495302] [Arthrobacter nicotinovorans]; contains Pfam profile PF01360: Monooxygenase Length = 408 Score = 27.9 bits (59), Expect = 2.5 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Query: 94 LKTNQSTLM--KDVSNKISEEMEKIWVPHCCKPNEQQK 129 LK+N TL +++ NK+ +E E IW+P + + K Sbjct: 252 LKSNSVTLKVSQEMINKMHQEAETIWIPELARLMSETK 289 >At3g20960.1 68416.m02649 cytochrome P450 family protein similar to Cytochrome P450 93A1 (SP:Q42798) {Glycine max}; Length = 418 Score = 27.5 bits (58), Expect = 3.3 Identities = 13/26 (50%), Positives = 18/26 (69%) Query: 104 DVSNKISEEMEKIWVPHCCKPNEQQK 129 DVSN+ +E +EKI V H K +E+ K Sbjct: 147 DVSNRFNELLEKILVEHNEKLDEEHK 172 >At5g13600.1 68418.m01574 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000; contains BTB/POZ domain, Pfam:PF00651 Length = 591 Score = 27.1 bits (57), Expect = 4.4 Identities = 14/57 (24%), Positives = 28/57 (49%) Query: 59 YQTFLYYNEAELRQVFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEEMEK 115 Y +YY+ E R + ++E LP + +S L+ +++++ S E +EK Sbjct: 271 YGDDMYYSHEEQRSLLEEIVELLPGKKCVTSTKFLLRLLRTSMVLHASQVTQETLEK 327 >At4g37100.1 68417.m05255 hypothetical protein Length = 896 Score = 26.6 bits (56), Expect = 5.8 Identities = 17/64 (26%), Positives = 29/64 (45%) Query: 65 YNEAELRQVFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEEMEKIWVPHCCKP 124 + E E V + + +E + S S + QS L D NKI+ + IW+ + K Sbjct: 479 FEETESVSVGELMKSPVFSEDESSDNSFWIDLGQSPLGSDQHNKIASPLPPIWLTNKRKQ 538 Query: 125 NEQQ 128 ++Q Sbjct: 539 KQRQ 542 >At4g30230.1 68417.m04299 hypothetical protein Length = 260 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 21 NPSLKVPQKLPKGISHRIEVAAQIASFCKDLGYK 54 N +L+ P KLPK H +E + A +DL K Sbjct: 6 NTNLQNPTKLPKPFQHHLEEEKEDALSLRDLPLK 39 >At3g09080.1 68416.m01067 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats; similar to JNK-binding protein JNKBP1 (GP:6069583) [Mus musculus] Length = 1026 Score = 26.6 bits (56), Expect = 5.8 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Query: 73 VFMFLIERLPNEGKQSSVSASLKT---NQSTLM-KDVSNKISEEMEKIWVPH 120 VF+ I L + +S L+ +++ LM DVS+K+SE + KI + H Sbjct: 964 VFVQSISELSTASPRDQISGELRAQLFDEAALMIPDVSHKVSEIVAKIMLEH 1015 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 26.6 bits (56), Expect = 5.8 Identities = 18/78 (23%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Query: 45 ASFCKDLGYKNDVGYQTF----LYYNE--AELRQVFMFLIERLPNEGKQSSVSASLKTNQ 98 A + D+GY+ +G + F +Y N+ L V I+ P + +++ + + Sbjct: 274 APYTCDVGYERFLGPEVFFNPEIYSNDFTTTLPAVIDKCIQSAPIDTRRALYKNIVLSGG 333 Query: 99 STLMKDVSNKISEEMEKI 116 ST+ KD ++ +++KI Sbjct: 334 STMFKDFGRRLQRDLKKI 351 >At5g55530.3 68418.m06918 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.2 bits (55), Expect = 7.6 Identities = 17/72 (23%), Positives = 35/72 (48%) Query: 61 TFLYYNEAELRQVFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEEMEKIWVPH 120 T LY++ A Q+ + P+ S+ +S+ +++T + S + E++KI P Sbjct: 162 TDLYHSPAGFVQLSLSYYGSYPDVMAIPSMPSSVSIDETTKDPEGSESVPGELDKIEFPD 221 Query: 121 CCKPNEQQKGIT 132 NE +K ++ Sbjct: 222 PNVANENEKMVS 233 >At5g55530.2 68418.m06917 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.2 bits (55), Expect = 7.6 Identities = 17/72 (23%), Positives = 35/72 (48%) Query: 61 TFLYYNEAELRQVFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEEMEKIWVPH 120 T LY++ A Q+ + P+ S+ +S+ +++T + S + E++KI P Sbjct: 162 TDLYHSPAGFVQLSLSYYGSYPDVMAIPSMPSSVSIDETTKDPEGSESVPGELDKIEFPD 221 Query: 121 CCKPNEQQKGIT 132 NE +K ++ Sbjct: 222 PNVANENEKMVS 233 >At5g55530.1 68418.m06916 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.2 bits (55), Expect = 7.6 Identities = 17/72 (23%), Positives = 35/72 (48%) Query: 61 TFLYYNEAELRQVFMFLIERLPNEGKQSSVSASLKTNQSTLMKDVSNKISEEMEKIWVPH 120 T LY++ A Q+ + P+ S+ +S+ +++T + S + E++KI P Sbjct: 162 TDLYHSPAGFVQLSLSYYGSYPDVMAIPSMPSSVSIDETTKDPEGSESVPGELDKIEFPD 221 Query: 121 CCKPNEQQKGIT 132 NE +K ++ Sbjct: 222 PNVANENEKMVS 233 >At5g45650.1 68418.m05613 subtilase family protein contains Pfam domain, PF00082: Subtilase family; contains Pfam domain, PF02225: protease associated (PA) domain Length = 791 Score = 26.2 bits (55), Expect = 7.6 Identities = 9/29 (31%), Positives = 17/29 (58%) Query: 8 FIIEAASKCLNAINPSLKVPQKLPKGISH 36 +++ S + I+P+ K P K+P G +H Sbjct: 658 YLLYGCSVNITNIDPTFKCPSKIPPGYNH 686 >At5g08600.1 68418.m01023 U3 ribonucleoprotein (Utp) family protein contains Pfam profile: PF04615 Utp14 protein Length = 822 Score = 26.2 bits (55), Expect = 7.6 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Query: 77 LIERLPNEGKQSSVSASL-KTNQSTLMKDVSNKISEEMEKIWVP 119 +I R+ + QS V A L K Q L +DV+N++ + IWVP Sbjct: 180 MISRMRKD-TQSLVHAPLPKPEQERLERDVANELVYKGFDIWVP 222 >At4g37080.2 68417.m05252 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 610 Score = 26.2 bits (55), Expect = 7.6 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Query: 77 LIERLPNEGK-QSSVSASLKTNQSTLMKDVSNKISEEMEKIWV 118 L +RL ++ K Q SVS S +++ +V+N++SE++ K V Sbjct: 290 LDDRLADQDKAQESVSGSSSEDKTLQSGNVANRVSEDLLKCLV 332 >At4g37080.1 68417.m05253 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 597 Score = 26.2 bits (55), Expect = 7.6 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Query: 77 LIERLPNEGK-QSSVSASLKTNQSTLMKDVSNKISEEMEKIWV 118 L +RL ++ K Q SVS S +++ +V+N++SE++ K V Sbjct: 277 LDDRLADQDKAQESVSGSSSEDKTLQSGNVANRVSEDLLKCLV 319 >At4g35270.1 68417.m05012 RWP-RK domain-containing protein similar to nodule inception protein GI:6448579 from (Lotus japonicus); contains Pfam profile: PF02042 RWP-RK domain Length = 974 Score = 26.2 bits (55), Expect = 7.6 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 108 KISEEMEKIWVPHCCKPNEQQKGITSS 134 +IS+E + W+ H K NE+ KG++ S Sbjct: 553 EISQE-DSSWISHMIKANEKGKGVSLS 578 >At3g47660.1 68416.m05188 regulator of chromosome condensation (RCC1) family protein contains Pfam domain PF00415: Regulator of chromosome condensation (RCC1) Length = 951 Score = 26.2 bits (55), Expect = 7.6 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 82 PNEGKQSSVSASLKTNQSTLMKDVSNKISEEMEKIWVPHCCKPNEQQK 129 P G+QSS S + K+N ++ D S E +K HC P K Sbjct: 137 PENGEQSSSSQNSKSNIRSVSSDTS--YEEHAKKASGSHCNTPQRLGK 182 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.130 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,920,490 Number of Sequences: 28952 Number of extensions: 102135 Number of successful extensions: 367 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 9 Number of HSP's that attempted gapping in prelim test: 357 Number of HSP's gapped (non-prelim): 19 length of query: 135 length of database: 12,070,560 effective HSP length: 74 effective length of query: 61 effective length of database: 9,928,112 effective search space: 605614832 effective search space used: 605614832 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -