BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001219-TA|BGIBMGA001219- PA|IPR002573|Choline/ethanolamine kinase, IPR011009|Protein kinase-like (343 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 4.3 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 7.5 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/29 (27%), Positives = 15/29 (51%) Query: 90 YAVFENGLIYQYFPGDTLNIETVLDIKIW 118 + + N Y+ D L+ +T DI++W Sbjct: 106 FKTYSNVTTCSYYSLDDLSEDTFYDIRLW 134 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/31 (25%), Positives = 18/31 (58%) Query: 88 KLYAVFENGLIYQYFPGDTLNIETVLDIKIW 118 ++Y+V+E + + G L + +LDI ++ Sbjct: 47 EIYSVYERRYMNAHLSGIQLVVRNLLDISLY 77 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.139 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,151 Number of Sequences: 317 Number of extensions: 3554 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 343 length of database: 114,650 effective HSP length: 57 effective length of query: 286 effective length of database: 96,581 effective search space: 27622166 effective search space used: 27622166 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -