BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001218-TA|BGIBMGA001218-PA|IPR001023|Heat shock protein Hsp70, IPR013126|Heat shock protein 70 (840 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 24 4.4 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 24 5.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 5.9 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 24.2 bits (50), Expect = 4.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 69 GFKRLLGRKFSDPLVQKELK 88 G +LG K+ PL+QK LK Sbjct: 305 GLLSVLGYKYITPLIQKHLK 324 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Query: 311 QICAETFNRVERTLRAILHNAKLRSEDIH 339 Q C T N + T +L +LR+EDI+ Sbjct: 157 QACPYTLNIFDLTSDKLLRQYRLRAEDIN 185 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 5.9 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 7/103 (6%) Query: 588 VLVKTVELPIEAQTHGLSVHELNGYVEQEGKMQAQDRQEKERADARNALEEYVYELRGKL 647 VLV TV L A GLS + L + Q+ + + RQ E + +EE E L Sbjct: 183 VLVLTVTLSASAMVLGLSSYSLTEF--QQRRAFLETRQSLE---VQLVIEEQSTEQERLL 237 Query: 648 SEGETLHDFVAEDQRNKLVNHLDSVEQWLYDEGEDQNRQVYSD 690 L + VA R L LD+ + +Y + +Y+D Sbjct: 238 L--SVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYAD 278 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.130 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,954 Number of Sequences: 429 Number of extensions: 8556 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 20 Number of HSP's gapped (non-prelim): 3 length of query: 840 length of database: 140,377 effective HSP length: 64 effective length of query: 776 effective length of database: 112,921 effective search space: 87626696 effective search space used: 87626696 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -