BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001217-TA|BGIBMGA001217-PA|IPR012337|Polynucleotidyl transferase, Ribonuclease H fold, IPR006941|Ribonuclease CAF1 (205 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 3.6 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.3 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 3.6 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 7/80 (8%) Query: 58 LEFAELLMSSGI----VLMDNINWLSFHSGYDFGYL---LKLLTDQNLPHEENDFFERLR 110 +EF EL M G D + + +G+D Y +L+ + L H D+FE+L Sbjct: 210 IEFTELCMKLGWKSARTRFDILPLILSANGHDPDYFDIPNELVLEVPLSHPTYDWFEKLE 269 Query: 111 LYFPTVYDVKYLMKLCKNLK 130 L + V V ++ C L+ Sbjct: 270 LKWFAVPAVSGMVFDCGGLE 289 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 110 RLYFPTVYDVKYLMKLCK 127 R +F T++D+ +L CK Sbjct: 380 RNFFITMFDLDFLTNACK 397 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.139 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,785 Number of Sequences: 429 Number of extensions: 2703 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 205 length of database: 140,377 effective HSP length: 55 effective length of query: 150 effective length of database: 116,782 effective search space: 17517300 effective search space used: 17517300 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -