BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001215-TA|BGIBMGA001215-PA|undefined (274 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 26 0.42 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 1.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 1.3 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 24 1.3 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 1.3 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 1.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.3 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 1.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 1.7 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.1 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 5.1 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 5.1 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 5.1 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 5.1 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 5.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 5.1 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.1 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 6.8 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.8 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 9.0 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 9.0 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 21 9.0 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 25.8 bits (54), Expect = 0.42 Identities = 15/40 (37%), Positives = 21/40 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETSGI 175 +K LE + I+EI+ L K+RSP D + TS I Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTSNI 96 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDKSNTS 94 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSSTS 94 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYEIRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNTS 94 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + TS Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPGSRDRSNTS 94 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/27 (33%), Positives = 17/27 (62%) Query: 196 GLKDELEQKKKHISEENIAVKKDLEES 222 GL+ +++ K I E N+AV + E++ Sbjct: 434 GLRRRMDKLKSSIEEANLAVSAEREKN 460 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/44 (25%), Positives = 19/44 (43%) Query: 105 LEARNNLMXXXXXXXXXXXXXTEIMVANAMKLKTEELERKTTMI 148 + A N L+ T I A ++KTE ++ +TT + Sbjct: 108 IAAANPLLAEKLAAPSSQASPTSIPYATRAEIKTESIQPETTKV 151 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 136 LKTEELERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 +K LE + I+EI+ L K+RSP D + S Sbjct: 57 MKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 141 LERKTTMIKEIKLLSEIAKKARSPKIIDLTETS 173 LE + I+EI+ L K+RSP D + S Sbjct: 62 LEYELRRIREIEKLGSERSKSRSPDSRDRSNAS 94 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/44 (22%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 42 QGQISHEDAAIAKTILKQENRNKYEQFKKEKEIWTKELEKWKTN 85 Q + E++ + + +K EN N Y +F++ ++ ++ E + +N Sbjct: 624 QSSKNSENSIMQRASMK-ENLNVYPEFQENVQLCSEISESYSSN 666 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 63 NKYEQFKKEKEIWT 76 +KY++ KK+ E WT Sbjct: 151 SKYDKLKKKLEEWT 164 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 63 NKYEQFKKEKEIWT 76 +KY++ KK+ E WT Sbjct: 166 SKYDKLKKKLEEWT 179 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 63 NKYEQFKKEKEIWT 76 +KY++ KK+ E WT Sbjct: 54 SKYDKLKKKLEEWT 67 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.310 0.126 0.330 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,954 Number of Sequences: 429 Number of extensions: 2548 Number of successful extensions: 31 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 31 length of query: 274 length of database: 140,377 effective HSP length: 57 effective length of query: 217 effective length of database: 115,924 effective search space: 25155508 effective search space used: 25155508 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -