BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001210-TA|BGIBMGA001210-PA|IPR000210|BTB, IPR011526|Helix-turn-helix, Psq-like, IPR009057|Homeodomain-like, IPR013069|BTB/POZ, IPR007889|Helix-turn-helix, Psq (516 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 26 0.55 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 2.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 5.1 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 26.2 bits (55), Expect = 0.55 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 286 HRSDRSEDAHSPYTERSFEEETPRNFHPSPP 316 H S+ S A S YT + +E N+ P P Sbjct: 207 HSSESSFSAASSYTNTIYHQENFENYEPKSP 237 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.8 bits (49), Expect = 2.9 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Query: 307 TPRNFHP--SPPPTNFQHDVRAGLAPYVPPQQKPE 339 TP N P SP + D+ L P P +KP+ Sbjct: 107 TPPNSEPLVSPKSEKEEKDMETTLTPCASPNRKPD 141 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 5.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 296 SPYTERSFEEETPRNFHPSPPPTNFQHDVRAGLAP 330 +P + ++ E P +HP PPT+ + + L P Sbjct: 1359 NPGSTTNYPEWQPTEWHPPIPPTSEKPPLPEELKP 1393 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.133 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,410 Number of Sequences: 317 Number of extensions: 4427 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 516 length of database: 114,650 effective HSP length: 60 effective length of query: 456 effective length of database: 95,630 effective search space: 43607280 effective search space used: 43607280 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -