BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001208-TA|BGIBMGA001208-PA|IPR011046|WD40-like (782 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 28 0.28 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 24 4.6 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 8.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 8.0 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 27.9 bits (59), Expect = 0.28 Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 216 DDFSVMQVLYVDRLTNNVFLAIVNTGVLSAYADEINTV 253 D+ +V ++L +RL N F I++ G + ADE+ V Sbjct: 24 DNINVDEILASERLLKNYFNCIMDRGACTPDADELKRV 61 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 23.8 bits (49), Expect = 4.6 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 216 DDFSVMQVLYVDRLTNNVFLAIVNTGVLSAYADEI 250 D+ + ++L DRL N F ++ G S +E+ Sbjct: 29 DNIDLEEILKSDRLLKNYFNCLMERGTCSPDGEEL 63 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.0 bits (47), Expect = 8.0 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 690 IFTDRSVKKDIAPLLEQNVYKVLEK 714 IF D S +K LL +YKVLE+ Sbjct: 199 IFPD-SARKPFFKLLTSKIYKVLEE 222 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.0 bits (47), Expect = 8.0 Identities = 6/13 (46%), Positives = 11/13 (84%) Query: 36 GEVQIHRLHWQKV 48 G++Q ++HWQK+ Sbjct: 1346 GQLQASQIHWQKI 1358 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,683 Number of Sequences: 317 Number of extensions: 7971 Number of successful extensions: 25 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 5 length of query: 782 length of database: 114,650 effective HSP length: 62 effective length of query: 720 effective length of database: 94,996 effective search space: 68397120 effective search space used: 68397120 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -