BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001207-TA|BGIBMGA001207-PA|undefined (81 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0169 - 17959262-17959304,17959441-17959532,17959682-179597... 26 4.4 >03_04_0169 - 17959262-17959304,17959441-17959532,17959682-17959759, 17959938-17960075,17960174-17960302,17960556-17960685, 17960797-17960974,17961177-17961315,17961399-17961488, 17961633-17961794,17961966-17962130,17962250-17962387, 17962827-17963006,17963405-17963533,17963878-17964113, 17964233-17964395,17965260-17965628,17965724-17965828 Length = 887 Score = 25.8 bits (54), Expect = 4.4 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 36 PEDITMLIDTLQRT--QLDAFRELLDSVRQSATPTFDHQISYLVPVTK 81 PE + LI T Q Q+D RE+ + V +A T ++I ++ V + Sbjct: 717 PEIMVPLIGTPQELAQQVDVIREVAEKVFANAETTISYKIGSMIEVPR 764 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,743,655 Number of Sequences: 37544 Number of extensions: 37782 Number of successful extensions: 57 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 57 Number of HSP's gapped (non-prelim): 1 length of query: 81 length of database: 14,793,348 effective HSP length: 60 effective length of query: 21 effective length of database: 12,540,708 effective search space: 263354868 effective search space used: 263354868 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -