BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001207-TA|BGIBMGA001207-PA|undefined (81 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051888-1|AAK93312.1| 503|Drosophila melanogaster LD37690p pro... 25 9.5 AE014297-4320|AAF56856.1| 503|Drosophila melanogaster CG11877-P... 25 9.5 >AY051888-1|AAK93312.1| 503|Drosophila melanogaster LD37690p protein. Length = 503 Score = 25.4 bits (53), Expect = 9.5 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 6/52 (11%) Query: 36 PEDITMLID-TLQRTQ-LDAFRE----LLDSVRQSATPTFDHQISYLVPVTK 81 P+ + ML + L R + ++ RE LLDS++Q+A + ++Y+ P+ + Sbjct: 187 PDKVKMLENYVLDRVEKIEKLRETHLGLLDSIKQAARRSIQQLVTYVFPIAE 238 >AE014297-4320|AAF56856.1| 503|Drosophila melanogaster CG11877-PA protein. Length = 503 Score = 25.4 bits (53), Expect = 9.5 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 6/52 (11%) Query: 36 PEDITMLID-TLQRTQ-LDAFRE----LLDSVRQSATPTFDHQISYLVPVTK 81 P+ + ML + L R + ++ RE LLDS++Q+A + ++Y+ P+ + Sbjct: 187 PDKVKMLENYVLDRVEKIEKLRETHLGLLDSIKQAARRSIQQLVTYVFPIAE 238 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,076,383 Number of Sequences: 52641 Number of extensions: 69352 Number of successful extensions: 186 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 186 Number of HSP's gapped (non-prelim): 2 length of query: 81 length of database: 24,830,863 effective HSP length: 61 effective length of query: 20 effective length of database: 21,619,762 effective search space: 432395240 effective search space used: 432395240 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -