BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001203-TA|BGIBMGA001203-PA|undefined (141 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC141881-1|AAI41882.1| 1537|Homo sapiens WNK1 protein protein. 30 3.2 AJ296290-1|CAC15059.1| 2382|Homo sapiens putative protein kinase... 30 3.2 AB002342-1|BAA20802.2| 2066|Homo sapiens KIAA0344 protein. 30 3.2 >BC141881-1|AAI41882.1| 1537|Homo sapiens WNK1 protein protein. Length = 1537 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 5 SQIQPSILPRVPCAVTADAHSQTQSVIHTLDDLASYKNKIPVL--KHIPKGARN 56 SQ QP++LP P + S TQ +DD+ + + K+ L +H GA++ Sbjct: 775 SQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQH 828 >AJ296290-1|CAC15059.1| 2382|Homo sapiens putative protein kinase protein. Length = 2382 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 5 SQIQPSILPRVPCAVTADAHSQTQSVIHTLDDLASYKNKIPVL--KHIPKGARN 56 SQ QP++LP P + S TQ +DD+ + + K+ L +H GA++ Sbjct: 1620 SQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQH 1673 >AB002342-1|BAA20802.2| 2066|Homo sapiens KIAA0344 protein. Length = 2066 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 5 SQIQPSILPRVPCAVTADAHSQTQSVIHTLDDLASYKNKIPVL--KHIPKGARN 56 SQ QP++LP P + S TQ +DD+ + + K+ L +H GA++ Sbjct: 1305 SQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQH 1358 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,499,467 Number of Sequences: 224733 Number of extensions: 696975 Number of successful extensions: 4167 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 4167 Number of HSP's gapped (non-prelim): 3 length of query: 141 length of database: 73,234,838 effective HSP length: 83 effective length of query: 58 effective length of database: 54,581,999 effective search space: 3165755942 effective search space used: 3165755942 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -