BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001203-TA|BGIBMGA001203-PA|undefined (141 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68010-2|CAA92010.2| 433|Caenorhabditis elegans Hypothetical pr... 27 5.0 AB236333-1|BAE45265.1| 433|Caenorhabditis elegans MBlk-1 Relate... 27 5.0 AL132948-44|CAD31830.2| 410|Caenorhabditis elegans Hypothetical... 27 6.6 >Z68010-2|CAA92010.2| 433|Caenorhabditis elegans Hypothetical protein T01C1.2 protein. Length = 433 Score = 27.1 bits (57), Expect = 5.0 Identities = 15/47 (31%), Positives = 23/47 (48%) Query: 83 SSEAKKFIAAIGHRLRGQGHDPRSGSYLVQRLSIAIQRGNAASVMGT 129 +SE K +A H + D G+Y + RLSIA + +S + T Sbjct: 2 NSEPKPGLAMSSHFMGTDNQDQYKGTYAMNRLSIANLLNSPSSTLPT 48 >AB236333-1|BAE45265.1| 433|Caenorhabditis elegans MBlk-1 Related factor-1 protein. Length = 433 Score = 27.1 bits (57), Expect = 5.0 Identities = 15/47 (31%), Positives = 23/47 (48%) Query: 83 SSEAKKFIAAIGHRLRGQGHDPRSGSYLVQRLSIAIQRGNAASVMGT 129 +SE K +A H + D G+Y + RLSIA + +S + T Sbjct: 2 NSEPKPGLAMSSHFMGTDNQDQYKGTYAMNRLSIANLLNSPSSTLPT 48 >AL132948-44|CAD31830.2| 410|Caenorhabditis elegans Hypothetical protein Y39B6A.38 protein. Length = 410 Score = 26.6 bits (56), Expect = 6.6 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Query: 6 QIQPSILPRV----PCAVTADAHSQTQSVIHTLDDLASYKNKI 44 +I PS LPRV T D+ +QT ++++ +D+ S+ +KI Sbjct: 297 RITPSPLPRVIEEEKRITTTDSSTQTTELLYSEEDVKSFFSKI 339 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,199,721 Number of Sequences: 27539 Number of extensions: 114794 Number of successful extensions: 196 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 194 Number of HSP's gapped (non-prelim): 3 length of query: 141 length of database: 12,573,161 effective HSP length: 75 effective length of query: 66 effective length of database: 10,507,736 effective search space: 693510576 effective search space used: 693510576 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -