GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001203-TA|BGIBMGA001203-PA|undefined
         (141 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    20   8.7  

>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 12/44 (27%), Positives = 20/44 (45%)

Query: 62  LRVIMDGCINNNVAVETTGVWSSEAKKFIAAIGHRLRGQGHDPR 105
           LR  + G +  NV+V    + S +       +   L+ Q +DPR
Sbjct: 129 LRTHLRGTLTVNVSVLLLSLASPDESSLKYEVEFLLQQQWYDPR 172


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.134    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,808
Number of Sequences: 429
Number of extensions: 1376
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 141
length of database: 140,377
effective HSP length: 52
effective length of query: 89
effective length of database: 118,069
effective search space: 10508141
effective search space used: 10508141
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.3 bits)
S2: 40 (20.2 bits)