BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001203-TA|BGIBMGA001203-PA|undefined (141 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 20 8.7 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 20.2 bits (40), Expect = 8.7 Identities = 12/44 (27%), Positives = 20/44 (45%) Query: 62 LRVIMDGCINNNVAVETTGVWSSEAKKFIAAIGHRLRGQGHDPR 105 LR + G + NV+V + S + + L+ Q +DPR Sbjct: 129 LRTHLRGTLTVNVSVLLLSLASPDESSLKYEVEFLLQQQWYDPR 172 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,808 Number of Sequences: 429 Number of extensions: 1376 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 141 length of database: 140,377 effective HSP length: 52 effective length of query: 89 effective length of database: 118,069 effective search space: 10508141 effective search space used: 10508141 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.3 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -