BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001202-TA|BGIBMGA001202-PA|IPR001781|LIM, zinc-binding (517 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 0.96 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 3.9 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 23 6.8 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 23 6.8 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.4 bits (53), Expect = 0.96 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Query: 95 GGVRTNGACLEPRS--IAKAPPGEGCPRCGG 123 G NG CL+ K PPG PRC G Sbjct: 267 GACHNNGTCLDKVGGFECKCPPGFVGPRCEG 297 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.4 bits (48), Expect = 3.9 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 410 GHAPTLVSTDSEPT--VTYTEQLPFTGQK 436 GH TL++TD EP V + F+G++ Sbjct: 364 GHDLTLIATDGEPVHPVRVNTIISFSGER 392 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 3.9 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 410 GHAPTLVSTDSEPT--VTYTEQLPFTGQK 436 GH TL++TD EP V + F+G++ Sbjct: 364 GHDLTLIATDGEPVHPVRVNTIISFSGER 392 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 22.6 bits (46), Expect = 6.8 Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 234 IKAPPGKGCPRCGGVVFAAEQVLAKGREWHRKCFKCR 270 ++ P G + + + Q++ RE+HR + CR Sbjct: 76 MERPKGASNGKRARTAYTSSQLVELEREFHRSKYLCR 112 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 22.6 bits (46), Expect = 6.8 Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 234 IKAPPGKGCPRCGGVVFAAEQVLAKGREWHRKCFKCR 270 ++ P G + + + Q++ RE+HR + CR Sbjct: 96 MERPKGASNGKRARTAYTSSQLVELEREFHRSKYLCR 132 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.138 0.477 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,435 Number of Sequences: 317 Number of extensions: 5612 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 7 length of query: 517 length of database: 114,650 effective HSP length: 60 effective length of query: 457 effective length of database: 95,630 effective search space: 43702910 effective search space used: 43702910 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -