BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001199-TA|BGIBMGA001199-PA|undefined (129 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 0.52 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 1.6 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 0.52 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 60 LIELGLSFDFEWGERAVLRVGKNYHRGPIP 89 L + F E G V ++G++Y P+P Sbjct: 601 LFHCHIEFHVEVGMALVFKIGEDYEMPPVP 630 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 1.6 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Query: 19 SRAKPESGGGQPPIRVASYAADSDHWPAFGGARPAP 54 + ++ +SGG + S A DH P FG P P Sbjct: 48 TESEEKSGGSYSSNKNVSRA---DHSPVFGKVEPVP 80 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,854 Number of Sequences: 317 Number of extensions: 1259 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 129 length of database: 114,650 effective HSP length: 50 effective length of query: 79 effective length of database: 98,800 effective search space: 7805200 effective search space used: 7805200 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -