BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001199-TA|BGIBMGA001199-PA|undefined (129 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 3.3 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 4.4 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 4.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 4.4 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 22 5.8 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 22 7.7 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 22 7.7 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 22 7.7 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 22 7.7 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 22 7.7 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 84 HRGPIPSVIGIIQYTRGSSNYVVVNLRAAPSHTRRSRPA 122 H G I S IQ+ + + V ++ AAP+ + S PA Sbjct: 24 HHGSIASSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPA 62 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 7 AKRKVDKCRDTHSRAKPESGGGQP 30 +K K HS+ +P SGG P Sbjct: 389 SKSKFGAALAAHSQMQPNSGGSSP 412 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Query: 22 KPESGGGQPPIRVASYAADSDHWPAFGGARP 52 + +S +PP SY +DH G RP Sbjct: 397 REKSNPSRPPSVAGSYGKPNDHELDSSGGRP 427 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 22.6 bits (46), Expect = 4.4 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Query: 9 RKVDKCRDTHSRAKPESGG-----GQPPIRVASYAADSDHWP 45 RK+ R R P SGG PP R S + WP Sbjct: 248 RKIPPSRRNPRRRSPRSGGRWPSCRSPPARRRSRSTRPTSWP 289 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 22.2 bits (45), Expect = 5.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Query: 17 THSRAKPESGGGQPPIRVASYAADSDHWPAFGGARPAP 54 TH A +GG P RV DH G A P Sbjct: 174 THLIATNAAGGANPKYRVGDIMLIKDHINLMGFAGNNP 211 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.8 bits (44), Expect = 7.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 84 HRGPIPSVIGIIQYTRGSSNYVVVNLRAAPSHTRRSRPA 122 H G I + IQ+ + + V ++ AAP+ + S PA Sbjct: 24 HHGSIATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPA 62 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 21.8 bits (44), Expect = 7.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 84 HRGPIPSVIGIIQYTRGSSNYVVVNLRAAPSHTRRSRPA 122 H G I + IQ+ + + V ++ AAP+ + S PA Sbjct: 24 HHGSIATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPA 62 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.8 bits (44), Expect = 7.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 84 HRGPIPSVIGIIQYTRGSSNYVVVNLRAAPSHTRRSRPA 122 H G I + IQ+ + + V ++ AAP+ + S PA Sbjct: 24 HHGSIATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPA 62 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 21.8 bits (44), Expect = 7.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 84 HRGPIPSVIGIIQYTRGSSNYVVVNLRAAPSHTRRSRPA 122 H G I + IQ+ + + V ++ AAP+ + S PA Sbjct: 24 HHGSIATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPA 62 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.8 bits (44), Expect = 7.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 84 HRGPIPSVIGIIQYTRGSSNYVVVNLRAAPSHTRRSRPA 122 H G I + IQ+ + + V ++ AAP+ + S PA Sbjct: 24 HHGSIATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPA 62 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.134 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,772 Number of Sequences: 2123 Number of extensions: 5597 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 10 length of query: 129 length of database: 516,269 effective HSP length: 57 effective length of query: 72 effective length of database: 395,258 effective search space: 28458576 effective search space used: 28458576 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -