GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001198-TA|BGIBMGA001198-PA|IPR006671|Cyclin, N-terminal,
IPR004367|Cyclin, C-terminal, IPR006670|Cyclin, IPR011028|Cyclin-like
         (286 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    23   3.1  

>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 12/40 (30%), Positives = 20/40 (50%)

Query: 121 LSVDLLCAYTDNSVYPHEVRQWEIMLLQRLNWQLSVATAF 160
           +S+D   A TD   YP ++ +    +L  + W  S A +F
Sbjct: 140 ISLDRYWAITDPFTYPSKMSRRRAAVLIAIVWICSSAISF 179


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.133    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 70,582
Number of Sequences: 429
Number of extensions: 2244
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 286
length of database: 140,377
effective HSP length: 57
effective length of query: 229
effective length of database: 115,924
effective search space: 26546596
effective search space used: 26546596
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 43 (21.4 bits)