BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001196-TA|BGIBMGA001196-PA|IPR008331|Ferritin and Dps, IPR009040|Ferritin-like, IPR009078|Ferritin/ribonucleotide reductase-like (213 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.9 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 22 5.0 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 43 LINRQIQTEQQVAQHYLSLAVTFLNVKSLYHG 74 ++ +Q ++QQ Q + L LN+K+L HG Sbjct: 1225 VLGKQQPSQQQTQQQPIILPSQLLNIKTL-HG 1255 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 21.8 bits (44), Expect = 5.0 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Query: 162 LSEQIQSINEINHYIIKLSSFG----DDIHAIHNFDTSLIKLFPFSNRLNL 208 L E+ S I Y+ S F + H I N + L KL +NR N+ Sbjct: 58 LQEEDISEGNIKKYLTNYSCFITCALEKSHIIQNDEIQLDKLVEMANRKNI 108 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.324 0.139 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,954 Number of Sequences: 429 Number of extensions: 2438 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 213 length of database: 140,377 effective HSP length: 55 effective length of query: 158 effective length of database: 116,782 effective search space: 18451556 effective search space used: 18451556 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -