BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001196-TA|BGIBMGA001196-PA|IPR008331|Ferritin and Dps, IPR009040|Ferritin-like, IPR009078|Ferritin/ribonucleotide reductase-like (213 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56090.1 68416.m06234 ferritin, putative similar to ferritin ... 69 2e-12 At5g01600.1 68418.m00075 ferritin 1 (FER1) identical to ferritin... 69 3e-12 At2g40300.1 68415.m04964 ferritin, putative similar to ferritin ... 66 2e-11 At3g11050.1 68416.m01333 ferritin, putative similar to ferritin ... 61 5e-10 At1g21810.1 68414.m02729 expressed protein 30 1.0 At3g03200.1 68416.m00316 no apical meristem (NAM) family protein... 29 2.4 At5g55230.1 68418.m06884 microtubule associated protein (MAP65/A... 29 3.1 At3g02930.1 68416.m00288 expressed protein ; expression support... 29 3.1 At3g01185.1 68416.m00024 hypothetical protein 28 4.1 At1g02050.1 68414.m00125 chalcone and stilbene synthase family p... 28 4.1 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 28 5.5 At5g57260.1 68418.m07152 cytochrome P450 71B10 identical to cyto... 27 7.2 At5g28040.1 68418.m03378 expressed protein contains Pfam profil... 27 7.2 At3g16060.1 68416.m02030 kinesin motor family protein similar to... 27 9.5 At1g66920.1 68414.m07605 serine/threonine protein kinase, putati... 27 9.5 At1g55030.1 68414.m06285 F-box family protein contains F-box dom... 27 9.5 At1g25390.1 68414.m03152 protein kinase family protein contains ... 27 9.5 >At3g56090.1 68416.m06234 ferritin, putative similar to ferritin subunit cowpea2 precursor [Vigna unguiculata] GI:2970654; contains Pfam profile PF00210: Ferritin-like domain Length = 259 Score = 68.9 bits (161), Expect = 2e-12 Identities = 45/158 (28%), Positives = 76/158 (48%), Gaps = 5/158 (3%) Query: 44 INRQIQTEQQVAQHYLSLAVTFLNVKSLYHGAGGFFMKMYFEELDHMQGFIKYQLIRGNI 103 +N QI E V+ Y +L F G FF + EE +H + ++YQ RG Sbjct: 99 VNEQINVEYNVSYVYHALYAYFDRDNVALKGLAKFFKESSVEEREHAELLMEYQNKRGGR 158 Query: 104 PNICGIEKPNL----PDNLPLIEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVTS 159 + + P P+ + A +L +E+ VN+ L + + A+ D ADF+ S Sbjct: 159 VKLQPMVLPQSEFDHPEKGDALYAMELALSLEKLVNEKLLNLHSVASKNDDVQLADFIES 218 Query: 160 VYLSEQIQSINEINHYIIKLSSFGDDIHAIHNFDTSLI 197 V+L+EQ+++I +I+ Y+ +L G H +FD L+ Sbjct: 219 VFLNEQVEAIKKISEYVSQLRRLGKG-HGTWHFDQELL 255 >At5g01600.1 68418.m00075 ferritin 1 (FER1) identical to ferritin [Arabidopsis thaliana] GI:1246401, GI:8163920 Length = 255 Score = 68.5 bits (160), Expect = 3e-12 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 5/159 (3%) Query: 43 LINRQIQTEQQVAQHYLSLAVTFLNVKSLYHGAGGFFMKMYFEELDHMQGFIKYQLIRGN 102 +IN QI E V+ Y S+ F G FF + EE H + F++YQ RG Sbjct: 97 VINEQINVEYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRGG 156 Query: 103 I----PNICGIEKPNLPDNLPLIEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVT 158 P + I + + + A +L +E+ N+ L + A++ D ADFV Sbjct: 157 RVKLHPIVSPISEFEHAEKGDALYAMELALSLEKLTNEKLLNVHKVASENNDPQLADFVE 216 Query: 159 SVYLSEQIQSINEINHYIIKLSSFGDDIHAIHNFDTSLI 197 S +L EQI++I +I+ YI +L G H + +FD L+ Sbjct: 217 SEFLGEQIEAIKKISDYITQLRMIGKG-HGVWHFDQMLL 254 >At2g40300.1 68415.m04964 ferritin, putative similar to ferritin subunit cowpea2 precursor [Vigna unguiculata] GI:2970654; contains Pfam profile PF00210: Ferritin-like domain Length = 259 Score = 65.7 bits (153), Expect = 2e-11 Identities = 44/159 (27%), Positives = 74/159 (46%), Gaps = 5/159 (3%) Query: 44 INRQIQTEQQVAQHYLSLAVTFLNVKSLYHGAGGFFMKMYFEELDHMQGFIKYQLIRGNI 103 IN QI E V+ Y ++ F G FF + EE +H + ++YQ RG Sbjct: 101 INEQINVEYNVSYVYHAMYAYFDRDNIALKGLAKFFKESSLEEREHAEKLMEYQNKRGGR 160 Query: 104 PNICGIEKP----NLPDNLPLIEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVTS 159 + I P D + +L +E+ VN+ L + + A+ D H ADF+ S Sbjct: 161 VKLQSIVMPLSEFEHVDKGDALYGMELALSLEKLVNEKLLNLHSVASKNNDVHLADFIES 220 Query: 160 VYLSEQIQSINEINHYIIKLSSFGDDIHAIHNFDTSLIK 198 +L+EQ+++I I+ Y+ +L G H +F+ L++ Sbjct: 221 EFLTEQVEAIKLISEYVAQLRRVGKG-HGTWHFNQMLLE 258 >At3g11050.1 68416.m01333 ferritin, putative similar to ferritin subunit cowpea2 precursor GI:2970654 (Vigna unguiculata); contains Pfam profile PF00210: Ferritin-like domain Length = 253 Score = 61.3 bits (142), Expect = 5e-10 Identities = 44/158 (27%), Positives = 71/158 (44%), Gaps = 5/158 (3%) Query: 44 INRQIQTEQQVAQHYLSLAVTFLNVKSLYHGAGGFFMKMYFEELDHMQGFIKYQLIRGNI 103 IN QI E V+ Y +L F G FF EE H + F++YQ RG Sbjct: 93 INDQINVEYNVSYVYHALYAYFDRDNVGLKGFAKFFNDSSLEERGHAEMFMEYQNKRGGR 152 Query: 104 PNICGIEKP----NLPDNLPLIEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVTS 159 + I P + + + A +L +E+ N+ L ++ + D DFV S Sbjct: 153 VKLQSILMPVSEFDHEEKGDALHAMELALSLEKLTNEKLLKLQSVGVKNNDVQLVDFVES 212 Query: 160 VYLSEQIQSINEINHYIIKLSSFGDDIHAIHNFDTSLI 197 +L EQ+++I +I+ Y+ +L G H + +FD L+ Sbjct: 213 EFLGEQVEAIKKISEYVAQLRRIGKG-HGVWHFDQMLL 249 >At1g21810.1 68414.m02729 expressed protein Length = 628 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 6/70 (8%) Query: 129 KMEEQVNQLLEEIVTEANDIKDYHCADFVTSVYLSEQIQSINEINHYIIKLSSFGDDIHA 188 K+E ++ Q E+I T A D C + S L +Q+QS+ + ++I +S + Sbjct: 493 KVEPKIKQ--EDIATAAGKFAD--CQKTIAS--LGKQLQSLATLEEFLIDTASIPGSARS 546 Query: 189 IHNFDTSLIK 198 +HN + L K Sbjct: 547 VHNKEALLGK 556 >At3g03200.1 68416.m00316 no apical meristem (NAM) family protein similar to NAC2 (GI:6456751) {Arabidopsis thaliana} Length = 479 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Query: 92 GFIKYQLIRGNIPNIC---GIEKPNLPDNLPLIEAFRYSLKMEEQVNQLLEEIVTEANDI 148 G+IK Q IR ++ N G N DN+ + + + + E+ VNQ+ + N+ Sbjct: 325 GYIKEQKIRSSLDNTDEDPGFHGNNTNDNIDIDDFLSFDIYNEDNVNQIEDNEDVNTNET 384 Query: 149 KD 150 D Sbjct: 385 LD 386 >At5g55230.1 68418.m06884 microtubule associated protein (MAP65/ASE1) family protein low similarity to protein regulating cytokinesis 1 (PRC1) [Homo sapiens] GI:2865521; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 587 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query: 99 IRGNIPNICGIEKPNLPDNLPLIEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVT 158 ++ I ICG L + +P+++ SLK + L+E+ E +D + +FV+ Sbjct: 128 VQSQIQKICGDIAGGLSNEVPIVDESDLSLKKLDDFQSQLQELQKEKSD-RLRKVLEFVS 186 Query: 159 SVY 161 +V+ Sbjct: 187 TVH 189 >At3g02930.1 68416.m00288 expressed protein ; expression supported by MPSS Length = 806 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/51 (23%), Positives = 29/51 (56%) Query: 121 IEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVTSVYLSEQIQSINE 171 IE F E V + EE+ E ++K+ H ++ T + ++++++++N+ Sbjct: 147 IEKFEVVEAGIEAVQRKEEELKKELENVKNQHASESATLLLVTQELENVNQ 197 >At3g01185.1 68416.m00024 hypothetical protein Length = 140 Score = 28.3 bits (60), Expect = 4.1 Identities = 26/114 (22%), Positives = 45/114 (39%), Gaps = 7/114 (6%) Query: 104 PNICGIEKPNLPDNLPLIEAFRYSLKMEE----QVNQLLEEIVTEANDIKDYHCADFVTS 159 P++ EKP + N+ L F S E +N+ E+V A + + Sbjct: 15 PSLADDEKPLIDPNIDLDSTFARSPSTSEYNIDMLNKQSTELVQFAGTCAGLMGGEKCSD 74 Query: 160 VYLSEQIQSINEINHYIIKLSSFGDDIHAIHN---FDTSLIKLFPFSNRLNLYK 210 +SE +Q+I + +K+ +G + H + F T K F R + K Sbjct: 75 QVMSEILQNIPTSRYCCLKMIIYGQECHMVLRNLLFQTYYYKPFASKGRPRILK 128 >At1g02050.1 68414.m00125 chalcone and stilbene synthase family protein Similar to rice chalcone synthase homolog, gp|U90341|2507617 and anther specific protein, gp|Y14507|2326772 Length = 395 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Query: 3 INRLTVSNKLKLIKVKFYPQKIIIYNYSNVKKHTACKIADLINRQIQTEQQVAQHY-LSL 61 +NRL KLKL K K + + +Y NV +T + + + +++ + AQ + L L Sbjct: 319 LNRL--ETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRDELKKKGDAAQEWGLGL 376 Query: 62 A 62 A Sbjct: 377 A 377 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/51 (29%), Positives = 25/51 (49%) Query: 121 IEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVTSVYLSEQIQSINE 171 IE F+ E V EE+ E +K+ H +D V + ++++ INE Sbjct: 158 IEKFQAVEAGIEAVQNNEEELKKELETVKNQHASDSAALVAVRQELEKINE 208 >At5g57260.1 68418.m07152 cytochrome P450 71B10 identical to cytochrome P450 71B10 (SP:Q9LVD2) [Arabidopsis thaliana] Length = 1483 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/33 (30%), Positives = 21/33 (63%) Query: 164 EQIQSINEINHYIIKLSSFGDDIHAIHNFDTSL 196 +++Q +N++N IK + D H++H+ +SL Sbjct: 1429 QRLQFLNDVNEEEIKKKDYVHDFHSLHSTVSSL 1461 >At5g28040.1 68418.m03378 expressed protein contains Pfam profile: PF04504 protein of unknown function, DUF573 Length = 427 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 7/57 (12%) Query: 85 EELDHMQGFIKYQLIRGNIPNICGIEKPNLPDNLPLIEAFRYSLKMEEQVNQLLEEI 141 +E++ ++GF+ Y I N G + PD P E + L++E NQL+E++ Sbjct: 133 DEIELLRGFLDY------ITNHRG-NSSHPPDTAPFYEQIKSKLQLEFNKNQLVEKL 182 >At3g16060.1 68416.m02030 kinesin motor family protein similar to kinesin heavy chain member 2 GB:NP_032468 from [Mus musculus]; contains Pfam profile PF00225: Kinesin motor domain Length = 684 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 180 SSFGDDIHAIHNFDTSLIKLFPFSNRLN 207 S F + +H+FDT L+ P SN+L+ Sbjct: 97 SEFSPGLLDLHSFDTELLPEIPVSNQLD 124 >At1g66920.1 68414.m07605 serine/threonine protein kinase, putative similar to receptor serine/threonine kinase PR55K gi|1235680|gb|AAC49208; contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 609 Score = 27.1 bits (57), Expect = 9.5 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 150 DYHCADFVTSVYLSEQIQSINEINH 174 + HC D +TS+ +S+ + + INH Sbjct: 63 ELHCLDNITSLTISDHLYHVLSINH 87 >At1g55030.1 68414.m06285 F-box family protein contains F-box domain Pfam:PF00646 Length = 422 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 104 PNICG--IEKPNLPDNLPLIEAFRYSLKMEEQVNQLLEEIVTEANDIKDYHCADFVTSV 160 P CG I P+L L L + + M E V++L+E +T+ ++I D F+TSV Sbjct: 216 PQHCGYTINTPSLK-YLKLEGSKAFESFMVENVSELIEVNITDVSEIIDEKLRVFLTSV 273 >At1g25390.1 68414.m03152 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 629 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 95 KYQLIRGNIPNICGIEKPNLPDNLPLIEAFR----YSLKMEEQVNQL 137 K+ R ++P+ CG+ K N N+P I+ + Y++K Q N + Sbjct: 38 KFPFFRTDMPSRCGLFKLNCSANIPEIQLEKDGKWYTVKSVSQANTI 84 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.324 0.139 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,840,560 Number of Sequences: 28952 Number of extensions: 191104 Number of successful extensions: 482 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 467 Number of HSP's gapped (non-prelim): 18 length of query: 213 length of database: 12,070,560 effective HSP length: 78 effective length of query: 135 effective length of database: 9,812,304 effective search space: 1324661040 effective search space used: 1324661040 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -