BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001195-TA|BGIBMGA001195-PA|undefined (150 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 2.3 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 22 3.1 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 7.1 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 2.3 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Query: 15 KPELKT-SLKRISHAIFDCGGI 35 K ELK ++ +S +FDCGG+ Sbjct: 267 KLELKWFAVPAVSGMVFDCGGL 288 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.8 bits (44), Expect = 3.1 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Query: 113 PAYREDVQKMIQ--IGKTQVNRFTYKFKYN 140 PAYR +VQK I G + + Y +++N Sbjct: 102 PAYRAEVQKAISECKGIAKGDNCEYAYRFN 131 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 7.1 Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 127 KTQVNRFTYKFKYNSGLDY 145 KT N YK+ YN+ +Y Sbjct: 88 KTIHNNNNYKYNYNNKYNY 106 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.139 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,967 Number of Sequences: 429 Number of extensions: 2153 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 150 length of database: 140,377 effective HSP length: 53 effective length of query: 97 effective length of database: 117,640 effective search space: 11411080 effective search space used: 11411080 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -