GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001194-TA|BGIBMGA001194-PA|IPR001412|Aminoacyl-tRNA
synthetase, class I, IPR000924|Glutamyl-tRNA synthetase, class Ic,
IPR007639|Glutaminyl-tRNA synthetase, non-specific RNA-binding region
part 1, IPR007638|Glutaminyl-tRNA synthetase, non-specific RNA-binding
region part 2, IPR005113|uDENN, IPR001194|DENN, IPR011035|Ribosomal
protein L25-like
         (2195 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    29   1.0  

>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
            methoprene-tolerant protein protein.
          Length = 1115

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 968  EPEGSVLKSHLKQALNSLTNTTAEQASALLMPSRRDSVGGATLKVQPTWYKGGA 1021
            EP G +  S L Q ++++T+T A  A+ L+MPS   +  G   + Q T   G A
Sbjct: 1048 EPNGMLCNS-LSQRVSTITSTMAAAATPLMMPSVITTSVGQQQQQQRTAATGSA 1100


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.316    0.133    0.390 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,038,296
Number of Sequences: 2123
Number of extensions: 81056
Number of successful extensions: 181
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 178
Number of HSP's gapped (non-prelim): 3
length of query: 2195
length of database: 516,269
effective HSP length: 75
effective length of query: 2120
effective length of database: 357,044
effective search space: 756933280
effective search space used: 756933280
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 55 (26.2 bits)