BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001193-TA|BGIBMGA001193-PA|undefined (234 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14C8.16c |bot1||mitochondrial ribosomal protein subunit S35 ... 30 0.33 SPAC6F6.18c |mug169||sequence orphan|Schizosaccharomyces pombe|c... 28 1.0 SPBC8D2.15 |||mitochondrial lipoic acid synthetase |Schizosaccha... 27 1.8 SPCC31H12.08c |ccr4|SPCC5E4.02c|CCR4-Not complex subunit Ccr4 |S... 26 4.1 SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharo... 26 5.4 SPBC3E7.11c |||DNAJ protein Caj1/Djp1-type|Schizosaccharomyces p... 26 5.4 >SPBC14C8.16c |bot1||mitochondrial ribosomal protein subunit S35 |Schizosaccharomyces pombe|chr 2|||Manual Length = 315 Score = 29.9 bits (64), Expect = 0.33 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query: 101 SLTAKVKENANNNSPYFLEDFKHKPRSIVKRIEAKVHEGDLRGA-VRLLVSEDSLAPFND 159 S + V N N P+ L F PR I + K+ + L+GA + +L + + +P Sbjct: 105 SSSGNVGLGPNTNQPFPLNPFFKPPRPISHSLRMKITDEYLQGASIEVLARKFNTSPQRI 164 Query: 160 ETLSALR 166 E L LR Sbjct: 165 EALIKLR 171 >SPAC6F6.18c |mug169||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/60 (26%), Positives = 28/60 (46%) Query: 73 NNNGVEDWVSLLSFSYTTLRIPDRGDPRSLTAKVKENANNNSPYFLEDFKHKPRSIVKRI 132 + +G+ W+ + SF++ G+P+++T NA SPY RSI + I Sbjct: 40 SQSGIIPWIQVESFNFQGCEGAVFGNPKAITTSALFNALLQSPYLAALANEFNRSIKEGI 99 >SPBC8D2.15 |||mitochondrial lipoic acid synthetase |Schizosaccharomyces pombe|chr 2|||Manual Length = 370 Score = 27.5 bits (58), Expect = 1.8 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Query: 2 PSLSGFNSL--FVVPRGLNVHISHDAHPQAQSVIHTLDDLASYKNKIPVLKHIPKGARNL 59 P SG L V GL+V +H+ + D A+Y+ + VLKH+ K +L Sbjct: 208 PDFSGRMDLVEIVAKSGLDV-FAHNVETVEELTPFVRDRRATYRQSLSVLKHVKKTCPHL 266 Query: 60 V 60 + Sbjct: 267 I 267 >SPCC31H12.08c |ccr4|SPCC5E4.02c|CCR4-Not complex subunit Ccr4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 690 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 202 SFYSGSAPGLDVPQGQHALIVRVPHA 227 + Y G+ PGL P QHA I+ V ++ Sbjct: 10 TIYPGAHPGLLTPDHQHAAILSVQNS 35 >SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 72 INNNGVEDWVSLLSFSYTTLRIPDRGDPRSLTAKVKENANNNSPY 116 IN ++D+ S Y T+ + DR +P + ++ N SP+ Sbjct: 309 INEEALDDFAGSAS-PYKTMSLTDRAEPIVMNGHMRSLHNATSPF 352 >SPBC3E7.11c |||DNAJ protein Caj1/Djp1-type|Schizosaccharomyces pombe|chr 2|||Manual Length = 355 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 28 QAQSVIHTLDDLASYKNKIPVLKHIPKGARNLVAGKL 64 + QSVI T+ D Y +P+ K I + L+ G++ Sbjct: 295 EVQSVIRTVSDKILYDKAVPLEKRINRANALLMIGQV 331 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.136 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,159,010 Number of Sequences: 5004 Number of extensions: 50619 Number of successful extensions: 143 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 139 Number of HSP's gapped (non-prelim): 6 length of query: 234 length of database: 2,362,478 effective HSP length: 71 effective length of query: 163 effective length of database: 2,007,194 effective search space: 327172622 effective search space used: 327172622 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -