BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001192-TA|BGIBMGA001192-PA|undefined (163 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_53106| Best HMM Match : PLAT (HMM E-Value=0) 27 10.0 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 115 KLMILSSKISEHDLMTSVRKMGKLVEKQ-YEVKVVLAGEGGQ 155 K M S++ EH+LM S++ + + VEK+ + V+ A + G+ Sbjct: 3707 KGMTAGSQLREHELMASLQMLLEKVEKEGFGVQAAHAAQAGR 3748 >SB_53106| Best HMM Match : PLAT (HMM E-Value=0) Length = 1790 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 125 EHDLMTSVRKMGKLVEKQYEVKVVLAGEGGQSSQVLVR 162 E DL + K+G++++ V + L G+ G+S ++ V+ Sbjct: 434 EVDLQPVLMKLGEVLDPHAPVHIQLLGDEGESGKIQVK 471 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.130 0.341 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,709,595 Number of Sequences: 59808 Number of extensions: 107376 Number of successful extensions: 203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 202 Number of HSP's gapped (non-prelim): 2 length of query: 163 length of database: 16,821,457 effective HSP length: 77 effective length of query: 86 effective length of database: 12,216,241 effective search space: 1050596726 effective search space used: 1050596726 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -