BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001189-TA|BGIBMGA001189-PA|undefined (109 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060713-1|AAL28261.1| 596|Drosophila melanogaster GH15479p pro... 26 8.9 AE014296-3503|AAF51694.1| 596|Drosophila melanogaster CG9389-PA... 26 8.9 >AY060713-1|AAL28261.1| 596|Drosophila melanogaster GH15479p protein. Length = 596 Score = 26.2 bits (55), Expect = 8.9 Identities = 15/48 (31%), Positives = 23/48 (47%) Query: 32 PGQCHNVHISTNFYYGFHEVKTSGINHMATDCEMQEVPIEKNVNTLVT 79 P Q + T F EVK +G +A + + QE +K+ N +VT Sbjct: 268 PDQFSASDLDTLFLLACREVKKAGAIALAENKKNQEYTTKKHTNDIVT 315 >AE014296-3503|AAF51694.1| 596|Drosophila melanogaster CG9389-PA protein. Length = 596 Score = 26.2 bits (55), Expect = 8.9 Identities = 15/48 (31%), Positives = 23/48 (47%) Query: 32 PGQCHNVHISTNFYYGFHEVKTSGINHMATDCEMQEVPIEKNVNTLVT 79 P Q + T F EVK +G +A + + QE +K+ N +VT Sbjct: 268 PDQFSASDLDTLFLLACREVKKAGAIALAENKKNQEYTTKKHTNDIVT 315 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.319 0.133 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,667,689 Number of Sequences: 52641 Number of extensions: 218679 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 481 Number of HSP's gapped (non-prelim): 2 length of query: 109 length of database: 24,830,863 effective HSP length: 75 effective length of query: 34 effective length of database: 20,882,788 effective search space: 710014792 effective search space used: 710014792 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -