BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001187-TA|BGIBMGA001187-PA|undefined (834 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 27 0.40 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 27 0.40 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 27 0.40 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 27 0.40 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 27 0.40 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 27 0.40 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 27 0.40 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 27 0.52 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 8.5 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 27.5 bits (58), Expect = 0.40 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNP----PQPLNTPKMQSAIIHIQHPLMSTA 511 D + P +TP LS +++N + LT+P P P +A ++ P ST+ Sbjct: 115 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 Query: 512 SATQVQ 517 S + + Sbjct: 175 STSSTE 180 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 27.5 bits (58), Expect = 0.40 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNP----PQPLNTPKMQSAIIHIQHPLMSTA 511 D + P +TP LS +++N + LT+P P P +A ++ P ST+ Sbjct: 115 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 Query: 512 SATQVQ 517 S + + Sbjct: 175 STSSTE 180 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 27.5 bits (58), Expect = 0.40 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNP----PQPLNTPKMQSAIIHIQHPLMSTA 511 D + P +TP LS +++N + LT+P P P +A ++ P ST+ Sbjct: 115 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 Query: 512 SATQVQ 517 S + + Sbjct: 175 STSSTE 180 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 27.5 bits (58), Expect = 0.40 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNP----PQPLNTPKMQSAIIHIQHPLMSTA 511 D + P +TP LS +++N + LT+P P P +A ++ P ST+ Sbjct: 115 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 Query: 512 SATQVQ 517 S + + Sbjct: 175 STSSTE 180 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 27.5 bits (58), Expect = 0.40 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNP----PQPLNTPKMQSAIIHIQHPLMSTA 511 D + P +TP LS +++N + LT+P P P +A ++ P ST+ Sbjct: 71 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 130 Query: 512 SATQVQ 517 S + + Sbjct: 131 STSSTE 136 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 27.5 bits (58), Expect = 0.40 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNP----PQPLNTPKMQSAIIHIQHPLMSTA 511 D + P +TP LS +++N + LT+P P P +A ++ P ST+ Sbjct: 115 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 Query: 512 SATQVQ 517 S + + Sbjct: 175 STSSTE 180 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 27.5 bits (58), Expect = 0.40 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNP----PQPLNTPKMQSAIIHIQHPLMSTA 511 D + P +TP LS +++N + LT+P P P +A ++ P ST+ Sbjct: 115 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 Query: 512 SATQVQ 517 S + + Sbjct: 175 STSSTE 180 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 27.1 bits (57), Expect = 0.52 Identities = 17/59 (28%), Positives = 27/59 (45%) Query: 456 DTALKQQPSPTTPRLSPQASTNQLLAQQLTNPPQPLNTPKMQSAIIHIQHPLMSTASAT 514 D + P +TP LS +++N + LT+P +P + A L S AS+T Sbjct: 115 DLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASST 173 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 459 LKQQPSPTTPRLSPQASTNQLLAQQLTNPPQP 490 +KQQ +P P +P S + L L+ P P Sbjct: 66 VKQQTAPHGPPYAPHPSLSSGLGGGLSGMPMP 97 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.130 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,129 Number of Sequences: 317 Number of extensions: 4829 Number of successful extensions: 38 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 24 length of query: 834 length of database: 114,650 effective HSP length: 63 effective length of query: 771 effective length of database: 94,679 effective search space: 72997509 effective search space used: 72997509 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -