BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001185-TA|BGIBMGA001185-PA|IPR011059|Metal-dependent hydrolase, composite, IPR003764|N-acetylglucosamine-6-phosphate deacetylase, IPR006680|Amidohydrolase 1 (398 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 27 0.91 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 27 0.91 AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-tran... 26 2.1 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 24 6.4 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 8.4 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 24 8.4 AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 24 8.4 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 27.1 bits (57), Expect = 0.91 Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 12 NCYILRDRKIIKEDLWIRDGKIENPERVF 40 NCY L + LWIRDG + +R F Sbjct: 44 NCYRLEGESREWKALWIRDGFFDEKQREF 72 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 27.1 bits (57), Expect = 0.91 Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 12 NCYILRDRKIIKEDLWIRDGKIENPERVF 40 NCY L + LWIRDG + +R F Sbjct: 44 NCYRLEGESREWKALWIRDGFFDGKQREF 72 >AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-transferase E3 protein. Length = 223 Score = 25.8 bits (54), Expect = 2.1 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 130 ATVLGVHLEGPFISPTKKGAHVESYIK-NPHRGIDTIRE 167 A ++G+ L+ +I KK E Y+K NP + T+ + Sbjct: 22 AKMIGIELDVQYIDLAKKENMTEEYLKMNPMHTVPTVND 60 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 24.2 bits (50), Expect = 6.4 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 6/64 (9%) Query: 179 TLAPE-LPGCFEAIKDLTNLGIKVALGHSIASLAEGEKAVECGANLITHLFNAMLPFHHR 237 T PE +P EA K T + + L + ++ G+ +FNA LP H++ Sbjct: 87 TFKPETVPVQHEAYKSFTEVE-----SSKVNELQQALSSLNAGSGSCAEVFNAYLPVHNK 141 Query: 238 DPGL 241 G+ Sbjct: 142 YIGV 145 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.8 bits (49), Expect = 8.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 235 HHRDPGLVGLLASTMKKQ 252 HH PGL GL+ + ++Q Sbjct: 164 HHHHPGLTGLMQAPSQQQ 181 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.8 bits (49), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Query: 241 LVGLLASTMKKQVYYGIIADGIHTHPAALRIANR 274 L G+LA T++ YY IA P L NR Sbjct: 313 LAGVLACTVESISYYPTIAQMCAAPPPPLHAINR 346 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 23.8 bits (49), Expect = 8.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 113 YRQILPRIKKTQGNKNGATV 132 Y++IL I+K Q N+ TV Sbjct: 42 YKEILTTIRKPQANRRSGTV 61 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 423,362 Number of Sequences: 2123 Number of extensions: 17492 Number of successful extensions: 23 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 9 length of query: 398 length of database: 516,269 effective HSP length: 65 effective length of query: 333 effective length of database: 378,274 effective search space: 125965242 effective search space used: 125965242 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -