BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001184-TA|BGIBMGA001184-PA|undefined (60 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 20 2.2 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 18 6.8 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 19.8 bits (39), Expect = 2.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 9 FQKIYSTLNKAITMERLQKIKLTCLSEYYAQ 39 F +YS E++ K KL C E++ Q Sbjct: 149 FSALYSLPILIFYEEKIVKGKLQCWIEFHPQ 179 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 18.2 bits (35), Expect = 6.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 16 LNKAITMERLQKIKLTCL 33 L+ A+ ERL K CL Sbjct: 28 LDAALKSERLMKSYFECL 45 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.130 0.346 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,661 Number of Sequences: 317 Number of extensions: 301 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 60 length of database: 114,650 effective HSP length: 40 effective length of query: 20 effective length of database: 101,970 effective search space: 2039400 effective search space used: 2039400 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.5 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -