BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001184-TA|BGIBMGA001184-PA|undefined (60 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 20 7.5 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 20 7.5 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 20 9.9 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 17 NKAITMERLQKIKLTCLSEYYAQ 39 N+A ERL + C+ + AQ Sbjct: 514 NRAALKERLHALSARCVEQLEAQ 536 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 17 NKAITMERLQKIKLTCLSEYYAQ 39 N+A ERL + C+ + AQ Sbjct: 558 NRAALKERLHALSARCVEQLEAQ 580 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 19.8 bits (39), Expect = 9.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Query: 16 LNKAITMERLQKIKLTCLSEYYAQIINLRGSPKKLASQIKTAKE 59 L K T+E L++ L Y A+ N P + + +A+E Sbjct: 106 LGKDFTLEELRERYHAVLLTYGAEQDNTLNIPNENLQNVLSARE 149 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.130 0.346 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,233 Number of Sequences: 2123 Number of extensions: 1093 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 60 length of database: 516,269 effective HSP length: 39 effective length of query: 21 effective length of database: 433,472 effective search space: 9102912 effective search space used: 9102912 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -