BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001181-TA|BGIBMGA001181-PA|undefined (77 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10356| Best HMM Match : WD40 (HMM E-Value=6e-10) 25 8.6 SB_8773| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 >SB_10356| Best HMM Match : WD40 (HMM E-Value=6e-10) Length = 283 Score = 25.0 bits (52), Expect = 8.6 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 35 GDDQL-DVRDATPASSQHEFLFFGRNGPIYVVDC 67 GD ++ DV + P S F F GP++ V+C Sbjct: 115 GDMEMGDVTSSVPLGSPVTFAFAPHVGPVFSVNC 148 >SB_8773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 25.0 bits (52), Expect = 8.6 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Query: 7 SAAKLFTTKVVNAVTAKEKRRCYFCTVTGD-DQLDVRDATPASSQHEF 53 S K F V N V E+ R FC +GD LD ++ P + E+ Sbjct: 158 SVQKAFKKDVKNLVDVLEELRNPFCEDSGDLLVLDTKEIMPCKTFKEY 205 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.323 0.135 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,450,382 Number of Sequences: 59808 Number of extensions: 81955 Number of successful extensions: 131 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 131 Number of HSP's gapped (non-prelim): 2 length of query: 77 length of database: 16,821,457 effective HSP length: 55 effective length of query: 22 effective length of database: 13,532,017 effective search space: 297704374 effective search space used: 297704374 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -