BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001180-TA|BGIBMGA001180-PA|IPR001356|Homeobox, IPR000047|Helix-turn-helix motif, lambda-like repressor, IPR009057|Homeodomain-like (132 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0134 + 26161904-26162776 43 9e-05 07_03_0126 - 13797395-13797451,13797590-13797707,13797802-13798004 42 1e-04 03_02_0033 - 5148513-5148806,5148928-5149271,5149391-5149472 42 1e-04 04_04_0667 + 27097741-27098085,27098203-27098547 42 2e-04 10_07_0134 + 13289641-13290216,13290435-13290914 41 4e-04 03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657 40 5e-04 07_03_1043 + 23506148-23506226,23506344-23506693,23506782-23507075 40 7e-04 09_06_0034 + 20370672-20371109,20371120-20371515 40 9e-04 09_04_0468 + 17848144-17848174,17849032-17849378,17849505-17849921 40 9e-04 02_05_0618 + 30400338-30400452,30400553-30400692,30400805-304010... 40 9e-04 08_02_1031 - 23796755-23797171,23797243-23797595,23797676-23797715 39 0.001 04_04_0710 - 27453135-27453480,27453647-27453726,27453893-274541... 39 0.001 01_06_0040 - 25874308-25874611,25875743-25875822,25876764-258769... 39 0.001 08_02_0670 - 19877091-19877618,19880033-19880436,19880505-19880622 39 0.002 02_01_0380 + 2757691-2758080,2758389-2758712 39 0.002 01_06_0212 + 27575406-27575604,27575723-27576241,27576371-27576387 38 0.002 04_04_0841 - 28574497-28574883,28575815-28576188,28576262-285764... 38 0.003 08_01_0246 - 2028701-2029060,2029149-2030606,2030729-2031160 37 0.005 06_01_0290 + 2122758-2123015,2123128-2123544 37 0.005 03_01_0630 + 4635297-4636220 37 0.005 09_03_0144 - 12728697-12729238,12729312-12729432 37 0.006 05_07_0112 - 27755604-27756449,27756624-27756887,27757428-277575... 37 0.006 08_01_0574 + 5103466-5103534,5104526-5104806,5104959-5105127 36 0.008 04_04_1231 - 31934745-31935125,31935230-31935325,31936215-319362... 36 0.008 02_04_0278 - 21507288-21507726,21507893-21507972,21508587-215088... 36 0.008 02_05_0286 - 27506925-27507278,27508439-27508812,27509041-275092... 36 0.011 10_08_0929 + 21633179-21633377,21633466-21633809,21633905-21634297 36 0.014 10_08_1025 - 22391267-22391767,22392641-22392736,22392838-223931... 35 0.019 10_06_0180 + 11526139-11526172,11526365-11527218 35 0.024 09_06_0020 - 20267190-20267612,20269086-20269495,20269573-202697... 35 0.024 06_01_0292 + 2136637-2137050,2137162-2137671 35 0.024 09_04_0318 - 16620177-16620582,16620686-16620765,16620873-166212... 34 0.032 06_03_1261 - 28814617-28814890,28814989-28815068,28815287-28815703 34 0.032 03_02_0256 + 6899424-6899876,6900084-6900163,6900475-6900820 34 0.032 06_01_0741 - 5510159-5510581,5510862-5511124,5511223-5511400,551... 32 0.13 08_02_0940 - 22822391-22822781,22822875-22823053,22823079-228234... 30 0.53 01_06_1818 - 40093327-40093384,40093501-40093580,40093661-400939... 30 0.53 07_03_1291 + 25545749-25546262,25546989-25547669,25547693-255477... 29 1.2 08_02_0052 + 11699468-11699700,11699799-11699916,11699991-117006... 29 1.6 03_05_0648 - 26403249-26403357,26405142-26405284,26405425-264056... 27 4.9 01_06_0968 + 33466574-33466607,33467087-33467115,33467438-334675... 27 4.9 06_01_0878 + 6735266-6735340,6735946-6736041,6738610-6738720,673... 26 8.6 05_03_0501 + 14744913-14745107,14745545-14745571,14746002-147460... 26 8.6 >02_05_0134 + 26161904-26162776 Length = 290 Score = 42.7 bits (96), Expect = 9e-05 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 15 YSDHQRLELEKEFHYSRY-ITIRRKAELAVSLGLSERQVKIWFQN 58 +++ Q LE FH R + R KAELA LGL RQV IWFQN Sbjct: 68 FTEEQVRSLETTFHARRAKLEPREKAELARELGLQPRQVAIWFQN 112 >07_03_0126 - 13797395-13797451,13797590-13797707,13797802-13798004 Length = 125 Score = 42.3 bits (95), Expect = 1e-04 Identities = 19/44 (43%), Positives = 26/44 (59%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++D Q LE F Y+ ++ +LA LG+ ERQVK WFQN Sbjct: 58 HTDDQIKHLESVFERCTYLGGNQRVQLAKKLGMEERQVKFWFQN 101 >03_02_0033 - 5148513-5148806,5148928-5149271,5149391-5149472 Length = 239 Score = 42.3 bits (95), Expect = 1e-04 Identities = 20/43 (46%), Positives = 24/43 (55%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 SD Q LE F R + RK +LA LGL +QV +WFQN Sbjct: 66 SDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQVAVWFQN 108 >04_04_0667 + 27097741-27098085,27098203-27098547 Length = 229 Score = 41.9 bits (94), Expect = 2e-04 Identities = 22/45 (48%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 15 YSDHQRLELEKEFH-YSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +++ Q LE FH + + R KAELA LGL RQV IWFQN Sbjct: 30 FTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVAIWFQN 74 >10_07_0134 + 13289641-13290216,13290435-13290914 Length = 351 Score = 40.7 bits (91), Expect = 4e-04 Identities = 19/36 (52%), Positives = 23/36 (63%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F + RKA+LA +LGL RQV IWFQN Sbjct: 116 LERSFESGNKLEPERKAQLARALGLQPRQVAIWFQN 151 >03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657 Length = 390 Score = 40.3 bits (90), Expect = 5e-04 Identities = 19/36 (52%), Positives = 22/36 (61%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LEK F + RK +LA +LGL RQV IWFQN Sbjct: 142 LEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQN 177 >07_03_1043 + 23506148-23506226,23506344-23506693,23506782-23507075 Length = 240 Score = 39.9 bits (89), Expect = 7e-04 Identities = 20/43 (46%), Positives = 23/43 (53%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 SD Q LE F R + RK LA LGL +QV +WFQN Sbjct: 67 SDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQN 109 >09_06_0034 + 20370672-20371109,20371120-20371515 Length = 277 Score = 39.5 bits (88), Expect = 9e-04 Identities = 20/44 (45%), Positives = 25/44 (56%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +S+ Q LE F + R+K +LA LGL RQV IWFQN Sbjct: 34 FSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQN 77 >09_04_0468 + 17848144-17848174,17849032-17849378,17849505-17849921 Length = 264 Score = 39.5 bits (88), Expect = 9e-04 Identities = 18/36 (50%), Positives = 21/36 (58%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F + RKA LA LGL RQV +WFQN Sbjct: 50 LERSFEVENKLEPERKARLARDLGLQPRQVAVWFQN 85 >02_05_0618 + 30400338-30400452,30400553-30400692,30400805-30401044, 30401157-30401693 Length = 343 Score = 39.5 bits (88), Expect = 9e-04 Identities = 18/36 (50%), Positives = 21/36 (58%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F + RK ELA LGL RQV +WFQN Sbjct: 89 LERSFEEENKLEPERKTELARKLGLQPRQVAVWFQN 124 >08_02_1031 - 23796755-23797171,23797243-23797595,23797676-23797715 Length = 269 Score = 39.1 bits (87), Expect = 0.001 Identities = 18/36 (50%), Positives = 21/36 (58%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F + RKA LA LGL RQV +WFQN Sbjct: 55 LERSFETENKLEPERKARLARDLGLQPRQVAVWFQN 90 >04_04_0710 - 27453135-27453480,27453647-27453726,27453893-27454107, 27454227-27454329 Length = 247 Score = 39.1 bits (87), Expect = 0.001 Identities = 20/43 (46%), Positives = 24/43 (55%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S Q LE F + R+KA LA LGL RQV++WFQN Sbjct: 87 SKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQN 129 >01_06_0040 - 25874308-25874611,25875743-25875822,25876764-25876996, 25877285-25877354 Length = 228 Score = 39.1 bits (87), Expect = 0.001 Identities = 18/43 (41%), Positives = 26/43 (60%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S Q LE+ F + +T ++K LA+ L L RQV++WFQN Sbjct: 82 SKEQSRLLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQN 124 >08_02_0670 - 19877091-19877618,19880033-19880436,19880505-19880622 Length = 349 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/36 (47%), Positives = 22/36 (61%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F + RK ELA LG++ RQV +WFQN Sbjct: 98 LERSFEEENKLEPERKTELARRLGMAPRQVAVWFQN 133 >02_01_0380 + 2757691-2758080,2758389-2758712 Length = 237 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE F ++ K ELA LGLS RQV++WFQN Sbjct: 118 LEDSFRAHNILSHAEKQELAGKLGLSARQVEVWFQN 153 >01_06_0212 + 27575406-27575604,27575723-27576241,27576371-27576387 Length = 244 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/45 (37%), Positives = 30/45 (66%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWF 56 R++ S +Q LEK + +Y + +AEL+ +GLS+RQ+++WF Sbjct: 50 RMMKSPYQLEVLEKTYAVEQYPSETLRAELSAKIGLSDRQLQMWF 94 >04_04_0841 - 28574497-28574883,28575815-28576188,28576262-28576439, 28576816-28576896,28578134-28578361,28578460-28578579, 28578646-28579353,28579471-28579588,28579686-28579978, 28580101-28580169 Length = 851 Score = 37.9 bits (84), Expect = 0.003 Identities = 19/44 (43%), Positives = 26/44 (59%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++ Q ELE F + +++AEL+ LGL RQVK WFQN Sbjct: 111 HTPQQIQELEAMFKECPHPDEKQRAELSKRLGLEPRQVKFWFQN 154 >08_01_0246 - 2028701-2029060,2029149-2030606,2030729-2031160 Length = 749 Score = 37.1 bits (82), Expect = 0.005 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +++ R K +R ++ HQ ELE F + +++ EL+ LGL QVK WFQN Sbjct: 84 NQRPRKKRYHR--HTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQN 138 >06_01_0290 + 2122758-2123015,2123128-2123544 Length = 224 Score = 37.1 bits (82), Expect = 0.005 Identities = 19/43 (44%), Positives = 25/43 (58%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S Q LE+ F +T ++K LA SL L RQV++WFQN Sbjct: 67 SKDQAAVLEECFKTHHTLTPKQKVALAKSLNLRPRQVEVWFQN 109 >03_01_0630 + 4635297-4636220 Length = 307 Score = 37.1 bits (82), Expect = 0.005 Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F + RKA +A LGL RQV +WFQN Sbjct: 54 LERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQN 89 >09_03_0144 - 12728697-12729238,12729312-12729432 Length = 220 Score = 36.7 bits (81), Expect = 0.006 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 23 LEKEFHYS-RYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F R + RK+ELA LG++ RQV +WFQN Sbjct: 104 LERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQN 140 >05_07_0112 - 27755604-27756449,27756624-27756887,27757428-27757532, 27757626-27758249,27759048-27759596,27759665-27760372, 27760449-27760658,27761266-27761421,27761524-27761664, 27762015-27762101,27762209-27762309,27763071-27763293, 27763384-27763548,27763621-27763713,27763801-27764292, 27764729-27764805,27765184-27765681,27765818-27766046 Length = 1855 Score = 36.7 bits (81), Expect = 0.006 Identities = 17/45 (37%), Positives = 29/45 (64%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWF 56 RV+ + +Q LE+ + Y +AEL+V LGL++RQ+++WF Sbjct: 60 RVMKTPYQLEVLERTYTEDPYPNETMRAELSVKLGLTDRQLQMWF 104 >08_01_0574 + 5103466-5103534,5104526-5104806,5104959-5105127 Length = 172 Score = 36.3 bits (80), Expect = 0.008 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +++ R K +R ++ HQ E+E F + +++ EL+ LGL QVK WFQN Sbjct: 96 NQRPRKKRYHR--HTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQN 150 >04_04_1231 - 31934745-31935125,31935230-31935325,31936215-31936277, 31936393-31936593,31936738-31936839,31936972-31937430, 31937524-31937712,31938325-31938442,31939033-31939307, 31939853-31939930 Length = 653 Score = 36.3 bits (80), Expect = 0.008 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +++ R K +R ++ HQ E+E F + +++ EL+ LGL QVK WFQN Sbjct: 97 NQRPRKKRYHR--HTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQN 151 >02_04_0278 - 21507288-21507726,21507893-21507972,21508587-21508840, 21508988-21509180 Length = 321 Score = 36.3 bits (80), Expect = 0.008 Identities = 18/43 (41%), Positives = 25/43 (58%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S Q LE F +T ++K++LA L L RQV++WFQN Sbjct: 130 SKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQN 172 >02_05_0286 - 27506925-27507278,27508439-27508812,27509041-27509218, 27510878-27511105,27511215-27511316,27511415-27512131, 27512270-27512387,27512500-27512744,27512854-27513054, 27513920-27514324 Length = 973 Score = 35.9 bits (79), Expect = 0.011 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S + K +Y ++ Q ELE F + +++AEL+ L L RQVK WFQN Sbjct: 262 SNSRKRKKRYHR-HTPQQIQELEALFKECPHPDEKQRAELSRRLSLDARQVKFWFQN 317 >10_08_0929 + 21633179-21633377,21633466-21633809,21633905-21634297 Length = 311 Score = 35.5 bits (78), Expect = 0.014 Identities = 18/43 (41%), Positives = 23/43 (53%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S Q LE F + ++KA LA L L RQV++WFQN Sbjct: 162 SKDQAAVLEDTFKEHNTLNPKQKAALARQLNLKPRQVEVWFQN 204 >10_08_1025 - 22391267-22391767,22392641-22392736,22392838-22393106, 22393257-22393431,22393503-22393718,22393819-22393926, 22394020-22394544,22394631-22394819,22394924-22395041, 22395172-22395437,22395521-22395658 Length = 866 Score = 35.1 bits (77), Expect = 0.019 Identities = 16/44 (36%), Positives = 26/44 (59%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++ HQ ++E F + +++ +L+ LGL RQVK WFQN Sbjct: 125 HTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQN 168 >10_06_0180 + 11526139-11526172,11526365-11527218 Length = 295 Score = 34.7 bits (76), Expect = 0.024 Identities = 16/36 (44%), Positives = 20/36 (55%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE+ F + RKA +A L L RQV +WFQN Sbjct: 67 LERSFEADNKLDPERKARIARDLRLHPRQVAVWFQN 102 >09_06_0020 - 20267190-20267612,20269086-20269495,20269573-20269747, 20270833-20271066,20271164-20271265,20271354-20272091, 20272204-20272321,20272417-20272667,20272768-20272932 Length = 871 Score = 34.7 bits (76), Expect = 0.024 Identities = 20/53 (37%), Positives = 27/53 (50%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R K K ++ Q ELE F + +++ EL+ L L RQVK WFQN Sbjct: 120 RKKKKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQN 172 >06_01_0292 + 2136637-2137050,2137162-2137671 Length = 307 Score = 34.7 bits (76), Expect = 0.024 Identities = 18/43 (41%), Positives = 24/43 (55%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S Q LE+ F + ++K LA LGL RQV++WFQN Sbjct: 119 SKDQAAVLEECFKTHSTLNPKQKVALANRLGLRPRQVEVWFQN 161 >09_04_0318 - 16620177-16620582,16620686-16620765,16620873-16621213, 16621298-16621559 Length = 362 Score = 34.3 bits (75), Expect = 0.032 Identities = 17/43 (39%), Positives = 23/43 (53%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S Q LE+ F + ++K LA L L RQV++WFQN Sbjct: 182 SKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQN 224 >06_03_1261 - 28814617-28814890,28814989-28815068,28815287-28815703 Length = 256 Score = 34.3 bits (75), Expect = 0.032 Identities = 16/36 (44%), Positives = 21/36 (58%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE F ++ +K ELA L L RQV++WFQN Sbjct: 127 LEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQN 162 >03_02_0256 + 6899424-6899876,6900084-6900163,6900475-6900820 Length = 292 Score = 34.3 bits (75), Expect = 0.032 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query: 7 TKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 T+ K R+ + Q LE F + ++K LA L L RQV++WFQN Sbjct: 125 TRKKLRL--TKEQSALLEDRFREHSTLNPKQKVALAKQLNLRPRQVEVWFQN 174 >06_01_0741 - 5510159-5510581,5510862-5511124,5511223-5511400, 5511411-5511698,5511801-5511899,5511973-5512440, 5512559-5512744,5512887-5513004,5513035-5513228 Length = 738 Score = 32.3 bits (70), Expect = 0.13 Identities = 12/22 (54%), Positives = 17/22 (77%) Query: 37 RKAELAVSLGLSERQVKIWFQN 58 ++A+L+ LGL RQ+K WFQN Sbjct: 77 QRAQLSRELGLEPRQIKFWFQN 98 >08_02_0940 - 22822391-22822781,22822875-22823053,22823079-22823428, 22823522-22823765 Length = 387 Score = 30.3 bits (65), Expect = 0.53 Identities = 12/23 (52%), Positives = 16/23 (69%) Query: 36 RRKAELAVSLGLSERQVKIWFQN 58 ++K LA L L RQV++WFQN Sbjct: 232 KQKVALAKQLNLRPRQVEVWFQN 254 >01_06_1818 - 40093327-40093384,40093501-40093580,40093661-40093946, 40095007-40095291,40095386-40095513,40095625-40096560, 40096650-40096712,40096801-40096854,40096963-40097139, 40097452-40097583,40097666-40097785,40097935-40098627, 40098760-40099158,40099263-40099271 Length = 1139 Score = 30.3 bits (65), Expect = 0.53 Identities = 15/43 (34%), Positives = 21/43 (48%) Query: 16 SDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S+ Q LE + + K LA L + RQV++WFQN Sbjct: 1075 SEEQLTVLENMYEAGSNLDQALKQGLAEKLNIKPRQVEVWFQN 1117 >07_03_1291 + 25545749-25546262,25546989-25547669,25547693-25547751, 25549152-25549242,25549330-25549743,25550191-25550243, 25550947-25551177,25551492-25551708,25551790-25551890, 25552446-25552532,25553536-25553676,25553839-25553961, 25554070-25554522,25554931-25555308,25555410-25556060, 25556264-25556368,25556482-25556707,25557204-25557241 Length = 1520 Score = 29.1 bits (62), Expect = 1.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQ 57 LE+ + +Y AE A S+GL+ QV+IWF+ Sbjct: 443 LERFYSEVQYPQSEDIAEYATSVGLTYNQVRIWFK 477 >08_02_0052 + 11699468-11699700,11699799-11699916,11699991-11700659, 11700741-11700842,11700921-11701181,11701838-11702009, 11702128-11702528,11703171-11703587 Length = 790 Score = 28.7 bits (61), Expect = 1.6 Identities = 17/58 (29%), Positives = 26/58 (44%) Query: 1 MSRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 M TR K + + + Q+ L + F +LA L ++E Q+K WFQN Sbjct: 54 MDTCTRKKPRRYQLLTMQQKETLNRAFQSCPNPDRNDLKKLAKELNMTETQIKYWFQN 111 >03_05_0648 - 26403249-26403357,26405142-26405284,26405425-26405675, 26405707-26405713 Length = 169 Score = 27.1 bits (57), Expect = 4.9 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 28 HYS-RYITIRRKAELAVSLGLSERQVKIWFQN 58 HY Y + KA LA S GL ++QV WF N Sbjct: 79 HYRWPYPSEAEKAALAESTGLDKKQVTNWFIN 110 >01_06_0968 + 33466574-33466607,33467087-33467115,33467438-33467595, 33468319-33468436,33468520-33468708,33469008-33469343, 33469468-33469569,33469696-33469890,33469993-33470155, 33470314-33470579,33470670-33470765,33470860-33471255, 33471403-33471501 Length = 726 Score = 27.1 bits (57), Expect = 4.9 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLE-LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S T K K R+ ++ E LE F + +K L+ + GL QVK WFQN Sbjct: 50 SSNTNEKRKRRLQRLTGKQSEVLEGFFSICGHPDDGQKRHLSETTGLGLDQVKFWFQN 107 >06_01_0878 + 6735266-6735340,6735946-6736041,6738610-6738720, 6738816-6739309,6739422-6739587,6739666-6739789, 6739874-6739986,6740085-6740693,6743095-6743385, 6743845-6743913,6744099-6744188,6744281-6744696, 6744882-6744969 Length = 913 Score = 26.2 bits (55), Expect = 8.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Query: 21 LELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 L+L+ F Y + K LA LGL+ QV WF + Sbjct: 716 LKLKAHFKEDPYPSRATKENLAQELGLTFNQVTKWFSS 753 >05_03_0501 + 14744913-14745107,14745545-14745571,14746002-14746097, 14746479-14746769 Length = 202 Score = 26.2 bits (55), Expect = 8.6 Identities = 9/21 (42%), Positives = 17/21 (80%) Query: 36 RRKAELAVSLGLSERQVKIWF 56 +R+ E A LGL+++Q+++WF Sbjct: 98 QRQVESAGELGLTDKQLQMWF 118 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.320 0.134 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,586,414 Number of Sequences: 37544 Number of extensions: 37789 Number of successful extensions: 110 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 67 Number of HSP's gapped (non-prelim): 43 length of query: 132 length of database: 14,793,348 effective HSP length: 75 effective length of query: 57 effective length of database: 11,977,548 effective search space: 682720236 effective search space used: 682720236 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -