BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001180-TA|BGIBMGA001180-PA|IPR001356|Homeobox, IPR000047|Helix-turn-helix motif, lambda-like repressor, IPR009057|Homeodomain-like (132 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32587| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_10407| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 5e-12 SB_8774| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 5e-12 SB_10405| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-12 SB_41100| Best HMM Match : Homeobox (HMM E-Value=1.5e-24) 66 1e-11 SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-11 SB_10406| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-11 SB_45690| Best HMM Match : Homeobox (HMM E-Value=4.6e-31) 64 4e-11 SB_16156| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-11 SB_30811| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) 63 8e-11 SB_53178| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) 63 8e-11 SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45) 61 3e-10 SB_48629| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-10 SB_22870| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_596| Best HMM Match : Homeobox (HMM E-Value=4.5e-32) 59 1e-09 SB_29192| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-09 SB_21878| Best HMM Match : Homeobox (HMM E-Value=1.5e-25) 56 1e-08 SB_39723| Best HMM Match : Homeobox (HMM E-Value=5.4e-32) 56 1e-08 SB_53176| Best HMM Match : Homeobox (HMM E-Value=0) 55 2e-08 SB_37814| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-08 SB_42150| Best HMM Match : Homeobox (HMM E-Value=1.8e-29) 55 2e-08 SB_18749| Best HMM Match : Homeobox (HMM E-Value=6.1e-28) 54 4e-08 SB_3037| Best HMM Match : Homeobox (HMM E-Value=4.3e-27) 54 5e-08 SB_29287| Best HMM Match : Homeobox (HMM E-Value=1.4e-25) 53 7e-08 SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-08 SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-08 SB_8992| Best HMM Match : Homeobox (HMM E-Value=1.4e-25) 53 7e-08 SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 9e-08 SB_58034| Best HMM Match : VWA (HMM E-Value=0) 52 1e-07 SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) 52 2e-07 SB_25357| Best HMM Match : Homeobox (HMM E-Value=8.3e-28) 52 2e-07 SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) 51 3e-07 SB_21452| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-07 SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-07 SB_49275| Best HMM Match : Homeobox (HMM E-Value=2.8e-27) 50 8e-07 SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) 49 1e-06 SB_57648| Best HMM Match : Homeobox (HMM E-Value=5.3e-30) 49 1e-06 SB_37787| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) 48 2e-06 SB_15| Best HMM Match : Homeobox (HMM E-Value=4.1e-30) 48 3e-06 SB_22129| Best HMM Match : Homeobox (HMM E-Value=4.6e-26) 48 3e-06 SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) 48 3e-06 SB_34953| Best HMM Match : Homeobox (HMM E-Value=1e-25) 47 4e-06 SB_26105| Best HMM Match : Homeobox (HMM E-Value=1.1e-30) 47 4e-06 SB_19758| Best HMM Match : Homeobox (HMM E-Value=1.6e-20) 47 6e-06 SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) 46 8e-06 SB_36166| Best HMM Match : Homeobox (HMM E-Value=2.6e-28) 46 1e-05 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) 45 2e-05 SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) 45 2e-05 SB_7899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_41749| Best HMM Match : Homeobox (HMM E-Value=4.1e-29) 44 3e-05 SB_29536| Best HMM Match : Homeobox (HMM E-Value=2.6e-30) 44 3e-05 SB_16450| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-05 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 44 3e-05 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 44 3e-05 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 44 3e-05 SB_21036| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) 44 5e-05 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 44 5e-05 SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 7e-05 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 42 1e-04 SB_11862| Best HMM Match : Homeobox (HMM E-Value=1.1e-16) 42 2e-04 SB_32283| Best HMM Match : Homeobox (HMM E-Value=4.5e-20) 42 2e-04 SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) 42 2e-04 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_52868| Best HMM Match : Homeobox (HMM E-Value=1.6e-23) 41 3e-04 SB_47478| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_16449| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_174| Best HMM Match : Homeobox (HMM E-Value=1.9e-19) 41 3e-04 SB_39292| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_11048| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 41 4e-04 SB_49340| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 41 4e-04 SB_18861| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 41 4e-04 SB_17558| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 41 4e-04 SB_16448| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 5e-04 SB_34509| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 5e-04 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 40 7e-04 SB_50832| Best HMM Match : Homeobox (HMM E-Value=8.7e-23) 40 9e-04 SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.001 SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_49289| Best HMM Match : Homeobox (HMM E-Value=6e-30) 38 0.003 SB_18528| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 38 0.004 SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28) 38 0.004 SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_11047| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) 37 0.005 SB_15284| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) 37 0.005 SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) 37 0.006 SB_34025| Best HMM Match : Homeobox (HMM E-Value=1.1e-35) 36 0.011 SB_22965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_5629| Best HMM Match : PAX (HMM E-Value=0) 35 0.019 SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.025 SB_45591| Best HMM Match : Homeobox (HMM E-Value=7.3e-18) 34 0.044 SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) 33 0.077 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.077 SB_14196| Best HMM Match : FG-GAP (HMM E-Value=0) 33 0.077 SB_54939| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.18 SB_54937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.54 SB_48109| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.54 SB_28488| Best HMM Match : PAX (HMM E-Value=0) 30 0.54 SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_5495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 28 2.2 SB_51509| Best HMM Match : Homeobox (HMM E-Value=2.3e-09) 28 2.9 SB_14839| Best HMM Match : Homeobox (HMM E-Value=4.3e-13) 28 2.9 SB_12335| Best HMM Match : Pou (HMM E-Value=0) 27 3.8 SB_10703| Best HMM Match : Homeobox (HMM E-Value=4.6e-08) 27 3.8 SB_53272| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_31091| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_37035| Best HMM Match : Homeobox (HMM E-Value=9.6e-09) 27 5.1 SB_4115| Best HMM Match : Homeobox (HMM E-Value=9.4e-08) 27 5.1 SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_5296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_1883| Best HMM Match : LIM (HMM E-Value=2.20004e-42) 27 6.7 >SB_32587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 72.5 bits (170), Expect = 1e-13 Identities = 33/55 (60%), Positives = 41/55 (74%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K T DK R +YS Q +ELEKEFHY+RY+ R+ E+A SL L+E+QVKIWFQN Sbjct: 64 KECTSDKNRTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKIWFQN 118 >SB_10407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 66.9 bits (156), Expect = 5e-12 Identities = 28/49 (57%), Positives = 39/49 (79%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +YR Y++ Q LELEKEFHY++Y+ R+ ELA ++ L+ERQVK+WFQN Sbjct: 101 RYRTSYTNRQLLELEKEFHYNKYLCGTRRRELANAMKLTERQVKVWFQN 149 >SB_8774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 66.9 bits (156), Expect = 5e-12 Identities = 30/51 (58%), Positives = 39/51 (76%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K + R+ Y+ Q LELEKEFH++RY+T R+ E+A L L+ERQVKIWFQN Sbjct: 148 KHRKRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKIWFQN 198 >SB_10405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 66.1 bits (154), Expect = 9e-12 Identities = 28/56 (50%), Positives = 42/56 (75%) Query: 3 RKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R R+ ++R Y++ Q LELEKEFH+++Y+ R+ E++ +L L+ERQVKIWFQN Sbjct: 75 RFVRSSKRHRTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKIWFQN 130 >SB_41100| Best HMM Match : Homeobox (HMM E-Value=1.5e-24) Length = 103 Score = 65.7 bits (153), Expect = 1e-11 Identities = 30/53 (56%), Positives = 39/53 (73%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + + + R Y+ Q+LELEKEF YSRYIT R+ ELA +L LSE+ +KIWFQN Sbjct: 16 QVRSRARTAYTASQQLELEKEFLYSRYITRTRRKELANTLDLSEKHIKIWFQN 68 >SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 64.9 bits (151), Expect = 2e-11 Identities = 31/55 (56%), Positives = 38/55 (69%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 KT K K R +S HQ ELE EF + Y+T R+ E+AVSL L+ERQVK+WFQN Sbjct: 138 KTTRKRKERTAFSKHQLQELENEFIRNNYLTRLRRYEIAVSLDLTERQVKVWFQN 192 >SB_10406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 64.5 bits (150), Expect = 3e-11 Identities = 27/53 (50%), Positives = 40/53 (75%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++R Y++ Q LELEKEFH+++Y+ R+ E++ +L L+ERQVKIWFQN Sbjct: 168 RESKRHRTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKIWFQN 220 >SB_45690| Best HMM Match : Homeobox (HMM E-Value=4.6e-31) Length = 255 Score = 64.1 bits (149), Expect = 4e-11 Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S + K K R Y+ Q LELEKEFH++ ++T R++E+A L L+ERQVKIWFQN Sbjct: 130 SNRAEGKRK-RTAYTRKQLLELEKEFHFNHFLTKERRSEMASQLNLTERQVKIWFQN 185 >SB_16156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 64.1 bits (149), Expect = 4e-11 Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S + K K R Y+ Q LELEKEFH++ ++T R++E+A L L+ERQVKIWFQN Sbjct: 130 SNRAEGKRK-RTAYTRKQLLELEKEFHFNHFLTKERRSEMASQLNLTERQVKIWFQN 185 >SB_30811| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) Length = 133 Score = 62.9 bits (146), Expect = 8e-11 Identities = 26/49 (53%), Positives = 37/49 (75%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R ++ Q +ELEKEFH+S+Y+T R+ E+A +L L+E Q+KIWFQN Sbjct: 24 KKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKIWFQN 72 >SB_53178| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) Length = 428 Score = 62.9 bits (146), Expect = 8e-11 Identities = 26/49 (53%), Positives = 37/49 (75%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R ++ Q +ELEKEFH+S+Y+T R+ E+A +L L+E Q+KIWFQN Sbjct: 251 KKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKIWFQN 299 >SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45) Length = 527 Score = 61.3 bits (142), Expect = 3e-10 Identities = 28/51 (54%), Positives = 36/51 (70%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R ++ HQ ELE EF + Y+T R+ E+AVSL L+ERQVK+WFQN Sbjct: 92 KRKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQN 142 Score = 49.2 bits (112), Expect = 1e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVK 53 K K R V+S +Q ELE+EF + Y+T R+ E+AVSL L ERQVK Sbjct: 350 KRKERTVFSKYQLTELEREFCRNNYLTRLRRYEIAVSLDLGERQVK 395 >SB_48629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 60.9 bits (141), Expect = 3e-10 Identities = 28/51 (54%), Positives = 36/51 (70%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R ++ HQ ELE EF + Y+T R+ E+AVSL L+ERQVK+WFQN Sbjct: 145 KRKERTAFTTHQLRELENEFTRNNYLTRLRRYEIAVSLDLTERQVKVWFQN 195 >SB_22870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 59.7 bits (138), Expect = 8e-10 Identities = 28/56 (50%), Positives = 35/56 (62%) Query: 3 RKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 RK + R ++ Q L+LE EFH + YIT R+ ELA L L+E QVKIWFQN Sbjct: 111 RKENKPRRQRTTFTSEQTLKLELEFHQNEYITRSRRFELAACLNLTETQVKIWFQN 166 >SB_596| Best HMM Match : Homeobox (HMM E-Value=4.5e-32) Length = 162 Score = 59.3 bits (137), Expect = 1e-09 Identities = 27/57 (47%), Positives = 39/57 (68%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 SR TK + R +++ Q +LE EF S+Y+++ R+ ELA SL L+E Q+KIWFQN Sbjct: 20 SRGDDTKKRPRTAFTNEQIKDLEAEFQKSKYLSVSRRMELANSLSLTETQIKIWFQN 76 >SB_29192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 58.4 bits (135), Expect = 2e-09 Identities = 28/54 (51%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Query: 5 TRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +R+K + R Y+ Q LELEKEF +RY++ R+ ++A L LSE+QVKIWFQN Sbjct: 299 SRSK-RIRTAYTSMQLLELEKEFSQNRYLSRLRRIQIAALLDLSEKQVKIWFQN 351 >SB_21878| Best HMM Match : Homeobox (HMM E-Value=1.5e-25) Length = 99 Score = 56.0 bits (129), Expect = 1e-08 Identities = 26/47 (55%), Positives = 32/47 (68%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R V++ QR LEK F +YITI + +LA LGLSE QVK+WFQN Sbjct: 11 RPVFTQLQRRGLEKRFQVQKYITIHDRYQLAAMLGLSETQVKVWFQN 57 >SB_39723| Best HMM Match : Homeobox (HMM E-Value=5.4e-32) Length = 257 Score = 55.6 bits (128), Expect = 1e-08 Identities = 25/47 (53%), Positives = 33/47 (70%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R +S HQ L LE++F +Y+T ++ ELA SL L+E QVKIWFQN Sbjct: 110 RTAFSSHQLLALERQFQLHKYLTRPQRYELATSLMLTETQVKIWFQN 156 >SB_53176| Best HMM Match : Homeobox (HMM E-Value=0) Length = 373 Score = 55.2 bits (127), Expect = 2e-08 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S TRT+ +YR ++ Q LEKEF Y++ R+ ELA +L LSE +KIWFQN Sbjct: 59 SEATRTR-RYRTAFTREQLKRLEKEFMRENYVSRTRRCELANALNLSETTIKIWFQN 114 Score = 55.2 bits (127), Expect = 2e-08 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S TRT+ +YR ++ Q LEKEF Y++ R+ ELA +L LSE +KIWFQN Sbjct: 214 SEATRTR-RYRTAFTREQLKRLEKEFMRENYVSRTRRCELANALNLSETTIKIWFQN 269 >SB_37814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 55.2 bits (127), Expect = 2e-08 Identities = 25/51 (49%), Positives = 35/51 (68%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R ++S +Q LEKEF +Y+T ++AEL+ LG++E QVK WFQN Sbjct: 201 KPKQRPLFSHNQIQRLEKEFKEEKYLTESKRAELSKDLGMTETQVKTWFQN 251 >SB_42150| Best HMM Match : Homeobox (HMM E-Value=1.8e-29) Length = 122 Score = 54.8 bits (126), Expect = 2e-08 Identities = 21/52 (40%), Positives = 37/52 (71%) Query: 7 TKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++ + R ++ Q L+LE+EFH +Y+++ ++ +A +L L+E QVKIWFQN Sbjct: 24 SRRRKRTAFTSKQLLQLEREFHNKKYVSLEERSVIATNLNLTEVQVKIWFQN 75 >SB_18749| Best HMM Match : Homeobox (HMM E-Value=6.1e-28) Length = 222 Score = 54.0 bits (124), Expect = 4e-08 Identities = 23/55 (41%), Positives = 35/55 (63%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K + K K R ++ Q ELEK+F +Y+T ++++A L ++E QVKIWFQN Sbjct: 105 KCKKKKKARTTFTGRQIFELEKQFEAKKYLTATERSDMASLLNVTETQVKIWFQN 159 >SB_3037| Best HMM Match : Homeobox (HMM E-Value=4.3e-27) Length = 308 Score = 53.6 bits (123), Expect = 5e-08 Identities = 24/49 (48%), Positives = 33/49 (67%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R +YS Q EL K F ++Y+ + +A+LA LGL++ QVKIWFQN Sbjct: 176 KPRTIYSSFQLRELNKRFIKTQYLALPERADLAAYLGLTQTQVKIWFQN 224 >SB_29287| Best HMM Match : Homeobox (HMM E-Value=1.4e-25) Length = 207 Score = 53.2 bits (122), Expect = 7e-08 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +RK R + R V+S+ QR LEK F +Y+T + +LA LGLS+ QVK+WFQN Sbjct: 126 TRKAR-RPWTRAVFSNLQRKGLEKRFQVQKYLTKADRHQLASMLGLSDNQVKVWFQN 181 >SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 53.2 bits (122), Expect = 7e-08 Identities = 27/55 (49%), Positives = 33/55 (60%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R K K R V+S Q +LE F RY++ +A LA L L+E QVKIWFQN Sbjct: 209 KKRRKKKTRTVFSRSQVYQLESTFDMKRYLSSSERAGLASQLHLTETQVKIWFQN 263 >SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 53.2 bits (122), Expect = 7e-08 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 2 SRKTRTKDKY-RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S + +K K+ R +S HQ LEK F ++Y+ +A LA SLG++E QVK+WFQN Sbjct: 128 STEDDSKRKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQN 185 >SB_8992| Best HMM Match : Homeobox (HMM E-Value=1.4e-25) Length = 156 Score = 53.2 bits (122), Expect = 7e-08 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +RK R + R V+S+ QR LEK F +Y+T + +LA LGLS+ QVK+WFQN Sbjct: 75 TRKAR-RPWTRAVFSNLQRKGLEKRFQVQKYLTKADRHQLASMLGLSDNQVKVWFQN 130 >SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 52.8 bits (121), Expect = 9e-08 Identities = 22/47 (46%), Positives = 34/47 (72%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q+LE+EKEF Y Y++ R+ E+ ++L LSE+QV+ WFQN Sbjct: 47 RSAFTTVQQLEIEKEFLYDHYVSRVRRIEIVMALDLSEKQVRTWFQN 93 >SB_58034| Best HMM Match : VWA (HMM E-Value=0) Length = 1203 Score = 52.4 bits (120), Expect = 1e-07 Identities = 25/57 (43%), Positives = 36/57 (63%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +R+ + K R ++S Q LEKEF RY+T ++AEL+ L ++E QVK WFQN Sbjct: 1010 TRRFFKRPKLRPLFSKTQLSRLEKEFEEKRYLTETKRAELSKDLEMTETQVKTWFQN 1066 Score = 50.8 bits (116), Expect = 4e-07 Identities = 23/57 (40%), Positives = 36/57 (63%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +R+ K R ++S Q LEKEF ++Y+T ++ +L+ LG++E QVK WFQN Sbjct: 1109 TRRLAKPTKLRPLFSKTQLSRLEKEFSGNKYLTESKREQLSKDLGMTETQVKTWFQN 1165 >SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 52.0 bits (119), Expect = 2e-07 Identities = 23/51 (45%), Positives = 34/51 (66%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R +++ Q ELEK F +Y+ + ++ELA +LGL++ QVK WFQN Sbjct: 402 KKKPRTAFTESQISELEKRFQSQKYLGSKERSELAGTLGLTDTQVKTWFQN 452 >SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) Length = 389 Score = 51.6 bits (118), Expect = 2e-07 Identities = 23/47 (48%), Positives = 32/47 (68%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R V+S+ QR LEK F +Y+T + +LA LGL++ QVK+WFQN Sbjct: 318 RAVFSNLQRKGLEKRFQVQKYLTKADRHQLASMLGLTDNQVKVWFQN 364 >SB_25357| Best HMM Match : Homeobox (HMM E-Value=8.3e-28) Length = 317 Score = 51.6 bits (118), Expect = 2e-07 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R K + R +S Q ELE+ F + +Y++ +A+LA +L L+E QVKIWFQN Sbjct: 127 KPRRK-RSRAAFSHQQVFELERRFSHQKYLSGPERADLAAALKLTETQVKIWFQN 180 >SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) Length = 166 Score = 51.2 bits (117), Expect = 3e-07 Identities = 22/47 (46%), Positives = 33/47 (70%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q + LE +F +RY+++ + LA+SLGL+E QVKIWFQN Sbjct: 52 RTAFTYEQLVALENKFKSTRYLSVCERLNLALSLGLTETQVKIWFQN 98 >SB_21452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 50.4 bits (115), Expect = 5e-07 Identities = 21/53 (39%), Positives = 34/53 (64%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + K +YR +S +Q ELE+ F + Y + + ELA LGL+E ++++WFQN Sbjct: 61 KKKTRYRTTFSQYQIEELERAFDKAPYPDVFAREELAAKLGLTEARIQVWFQN 113 >SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 50.4 bits (115), Expect = 5e-07 Identities = 24/49 (48%), Positives = 32/49 (65%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R V++D Q LEK F +Y+ +A+LA +LGL+E QVK WFQN Sbjct: 512 KSRTVFTDLQLRVLEKTFSEQKYLDTSSRAKLAQTLGLNETQVKTWFQN 560 >SB_49275| Best HMM Match : Homeobox (HMM E-Value=2.8e-27) Length = 116 Score = 49.6 bits (113), Expect = 8e-07 Identities = 20/53 (37%), Positives = 32/53 (60%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +T + R +++ +Q LEK F +Y+ + +LA L L+E QVK+WFQN Sbjct: 48 KTSKRCRTIFAPYQLQRLEKAFERQQYVAGEERRQLATGLNLTETQVKVWFQN 100 >SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) Length = 294 Score = 49.2 bits (112), Expect = 1e-06 Identities = 24/49 (48%), Positives = 31/49 (63%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R V++D Q LEK F +Y+ +A+LA LGL+E QVK WFQN Sbjct: 170 KSRTVFTDLQLRVLEKTFSEQKYLDSTNRAKLAQILGLNEAQVKTWFQN 218 >SB_57648| Best HMM Match : Homeobox (HMM E-Value=5.3e-30) Length = 205 Score = 49.2 bits (112), Expect = 1e-06 Identities = 23/49 (46%), Positives = 32/49 (65%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R V++D Q LEK F +Y+ +++LA +LGL+E QVK WFQN Sbjct: 122 KSRTVFTDLQLRVLEKTFSEQKYLDTSSRSKLAQTLGLNETQVKTWFQN 170 >SB_37787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.2 bits (112), Expect = 1e-06 Identities = 22/51 (43%), Positives = 35/51 (68%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K RV++S QR +LEK+F Y++ + +LA ++ L+ +QVK+WFQN Sbjct: 19 KRKQRVLFSKVQRKQLEKKFLEKPYLSYTERDQLARAVNLTAKQVKVWFQN 69 >SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) Length = 418 Score = 48.4 bits (110), Expect = 2e-06 Identities = 22/51 (43%), Positives = 32/51 (62%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K RV+++ Q ELE+ F RY++ + +LA + L+ QVKIWFQN Sbjct: 92 KRKRRVLFTKAQTYELERRFRQQRYLSAPEREQLARIINLTPTQVKIWFQN 142 >SB_15| Best HMM Match : Homeobox (HMM E-Value=4.1e-30) Length = 287 Score = 48.0 bits (109), Expect = 3e-06 Identities = 22/49 (44%), Positives = 30/49 (61%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + R ++S Q LE+EF +YI + LA LGL+E QVK+WFQN Sbjct: 213 RVRTIFSPDQLDRLEREFDNQQYIVGTERFYLATELGLTETQVKVWFQN 261 >SB_22129| Best HMM Match : Homeobox (HMM E-Value=4.6e-26) Length = 366 Score = 47.6 bits (108), Expect = 3e-06 Identities = 20/51 (39%), Positives = 32/51 (62%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R++++ Q ELE+ F +Y++ + +LA + L+ QVKIWFQN Sbjct: 224 KKKRRILFTKSQIFELERRFRQQKYLSANEREQLARIIDLTPTQVKIWFQN 274 >SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) Length = 561 Score = 47.6 bits (108), Expect = 3e-06 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 3/57 (5%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S K+R K R ++ Q LE++F +Y+TI + ELA S+ LS+ QVK WFQN Sbjct: 430 SSKSRRK---RTAFTSSQLKYLEEKFQEKKYLTISERNELAKSMYLSDTQVKTWFQN 483 >SB_34953| Best HMM Match : Homeobox (HMM E-Value=1e-25) Length = 200 Score = 47.2 bits (107), Expect = 4e-06 Identities = 22/55 (40%), Positives = 33/55 (60%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K + R ++ Q LE +F +S+Y+TI + +A SL L+ RQ+K WFQN Sbjct: 92 KLAKKRRKRTAFTSFQLKCLEDKFKFSKYLTIAERDMMARSLQLTNRQIKTWFQN 146 >SB_26105| Best HMM Match : Homeobox (HMM E-Value=1.1e-30) Length = 315 Score = 47.2 bits (107), Expect = 4e-06 Identities = 21/49 (42%), Positives = 30/49 (61%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + R +++ Q LEKEF +Y+ + LA SL L+E QVK+WFQN Sbjct: 250 RIRTIFTPEQLERLEKEFERQQYMVGAERHYLAASLNLTETQVKVWFQN 298 >SB_19758| Best HMM Match : Homeobox (HMM E-Value=1.6e-20) Length = 228 Score = 46.8 bits (106), Expect = 6e-06 Identities = 22/56 (39%), Positives = 33/56 (58%) Query: 3 RKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 RK K K R ++ Q LE+EF +YI+ R++ LA + L++ QV+ WFQN Sbjct: 115 RKHPKKQKQRPLFGQKQIQRLEEEFVCEKYISKSRRSALAAEIDLTDAQVRTWFQN 170 >SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) Length = 651 Score = 46.4 bits (105), Expect = 8e-06 Identities = 21/51 (41%), Positives = 30/51 (58%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + + R +S Q +LEK F + YI + ++A L LSE QVK+WFQN Sbjct: 544 RKRARTAFSAEQLKKLEKRFQANHYIVGEERQKIAKDLDLSEAQVKVWFQN 594 >SB_36166| Best HMM Match : Homeobox (HMM E-Value=2.6e-28) Length = 209 Score = 46.0 bits (104), Expect = 1e-05 Identities = 19/53 (35%), Positives = 34/53 (64%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R + K R +++ Q +ELE+ F Y +Y++ + ++A++LGL Q+ WFQN Sbjct: 121 RKRRKPRTCFTNRQIIELERRFMYQKYLSPSDRDDIAMALGLPGAQIITWFQN 173 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/57 (35%), Positives = 34/57 (59%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S R + +YR ++ +Q ELE+ F + Y + + LAV + L+E +V++WFQN Sbjct: 280 STAKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQVWFQN 336 >SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) Length = 197 Score = 45.2 bits (102), Expect = 2e-05 Identities = 21/53 (39%), Positives = 29/53 (54%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R + R ++ Q L LE F + YI + +LA L LSE Q+K+WFQN Sbjct: 89 RRPKRIRTAFTPTQLLHLENAFEKNHYIVGTERKQLASYLNLSETQIKVWFQN 141 >SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) Length = 275 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/49 (38%), Positives = 30/49 (61%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R +S Q LEK F +Y+ + + +LA++L +++ QVK WFQN Sbjct: 100 KNRSSFSAEQVFRLEKTFELQQYLGTKERQQLALALNMTDNQVKTWFQN 148 >SB_7899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 44.8 bits (101), Expect = 2e-05 Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R++++ Q ELE+ F +Y++ + LA + L+ QVKIWFQN Sbjct: 124 KKKKRILFTRSQIYELERRFRVQQYLSAPEREHLARMISLTPVQVKIWFQN 174 >SB_41749| Best HMM Match : Homeobox (HMM E-Value=4.1e-29) Length = 269 Score = 44.4 bits (100), Expect = 3e-05 Identities = 19/49 (38%), Positives = 30/49 (61%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +YR + Q ++E+ F + Y + ++EL+ GLSE QV+IWFQN Sbjct: 76 RYRATFDKAQIFQMERVFLLNHYPDVAARSELSRRTGLSESQVQIWFQN 124 >SB_29536| Best HMM Match : Homeobox (HMM E-Value=2.6e-30) Length = 179 Score = 44.4 bits (100), Expect = 3e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q LE EF Y+ ++ +LA L LSERQVK+WFQN Sbjct: 114 RTSFTPAQLDRLEDEFRVDMYVVGLKRMKLANDLNLSERQVKVWFQN 160 >SB_16450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 44.4 bits (100), Expect = 3e-05 Identities = 20/55 (36%), Positives = 34/55 (61%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R + R ++ +Q +LE+ F ++Y + + ELA+ L LSE +V++WFQN Sbjct: 88 KPRKVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQVWFQN 142 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 44.4 bits (100), Expect = 3e-05 Identities = 20/47 (42%), Positives = 31/47 (65%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R +S Q +LE+ F +Y++ +AE+A +L +S+ QVKIWFQN Sbjct: 83 RSFFSADQVNQLERVFAAHQYVSANERAEIAETLNMSDDQVKIWFQN 129 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 44.4 bits (100), Expect = 3e-05 Identities = 21/51 (41%), Positives = 30/51 (58%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R++++ Q LE+ F RY++ + ELA L+ QVKIWFQN Sbjct: 91 KRKRRILFTKAQTFILERRFTQQRYLSAPEREELARIANLTPAQVKIWFQN 141 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 44.4 bits (100), Expect = 3e-05 Identities = 19/47 (40%), Positives = 32/47 (68%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R +S Q +LE+ F +Y++ + +AE+A +L +++ QVKIWFQN Sbjct: 83 RSFFSADQVSQLERVFAARQYVSAKERAEIAETLNMTDDQVKIWFQN 129 >SB_21036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 44.0 bits (99), Expect = 4e-05 Identities = 19/53 (35%), Positives = 30/53 (56%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R + + R ++ Q ELEK F Y I + ELA + +SE ++++WFQN Sbjct: 66 RKQRRNRTTFTKQQLQELEKVFEKKHYPDIALREELAAKINISEARIQVWFQN 118 >SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 225 Score = 43.6 bits (98), Expect = 5e-05 Identities = 19/47 (40%), Positives = 28/47 (59%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q LE++F +Y+TI + LA S+ L+ QVK WFQN Sbjct: 103 RTAFTSSQLKSLEEKFQEKKYLTISERNSLAKSMHLTNTQVKTWFQN 149 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 43.6 bits (98), Expect = 5e-05 Identities = 19/47 (40%), Positives = 28/47 (59%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q LE++F +Y+TI + LA S+ L+ QVK WFQN Sbjct: 942 RTAFTSSQLKSLEEKFQEKKYLTISERNSLAKSMHLTNTQVKTWFQN 988 >SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 43.2 bits (97), Expect = 7e-05 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +R +R + + R ++ Q L LE F + Y+ + +LA L LSE QVK+WFQN Sbjct: 127 ARSSRVR-RVRTAFTPFQLLCLETSFDKNHYVVGTERKQLASYLKLSETQVKVWFQN 182 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/37 (43%), Positives = 28/37 (75%) Query: 22 ELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +LE+ F +Y++ + +AE+A +L +++ QVKIWFQN Sbjct: 3 QLERVFAAQQYVSAKERAEIAETLNMTDDQVKIWFQN 39 >SB_11862| Best HMM Match : Homeobox (HMM E-Value=1.1e-16) Length = 99 Score = 41.9 bits (94), Expect = 2e-04 Identities = 19/36 (52%), Positives = 24/36 (66%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LEK F +Y+ +A+LA LGL+E QVK WFQN Sbjct: 4 LEKTFSEQKYLDSTNRAKLAQILGLNEAQVKTWFQN 39 >SB_32283| Best HMM Match : Homeobox (HMM E-Value=4.5e-20) Length = 398 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/52 (34%), Positives = 31/52 (59%) Query: 7 TKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 T+ R +++HQ L++ F RY+ + +LA L ++++QVK WFQN Sbjct: 239 TRTTTRSFFTEHQVACLQRVFANRRYVCSSERQKLAKELNMTDQQVKTWFQN 290 >SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) Length = 1168 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/57 (31%), Positives = 33/57 (57%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S R K + R ++ +Q E+E+ F + Y + + +LA+ L+E +V++WFQN Sbjct: 398 SAPKRKKRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQVWFQN 454 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 41.5 bits (93), Expect = 2e-04 Identities = 19/47 (40%), Positives = 30/47 (63%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R +S Q +LE+ F +Y++ +AE+A +L +S+ QVK WFQN Sbjct: 83 RSFFSADQVNQLERVFAAHQYVSANERAEIAETLNMSDDQVKNWFQN 129 >SB_52868| Best HMM Match : Homeobox (HMM E-Value=1.6e-23) Length = 434 Score = 41.1 bits (92), Expect = 3e-04 Identities = 21/57 (36%), Positives = 33/57 (57%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 SRK + R+ +S Q LE +F + Y++ +L+ SL ++E +VKIWFQN Sbjct: 358 SRKHKLDRNPRIPFSASQLAALEAKFLDTHYLSSVEVRDLSSSLSVTEHRVKIWFQN 414 >SB_47478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 41.1 bits (92), Expect = 3e-04 Identities = 19/57 (33%), Positives = 34/57 (59%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S TR + + R ++ +Q LE+ F +RY I + E+A+ + L E +V++WF+N Sbjct: 37 SHPTRKQRRERTTFTKNQLEVLEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKN 93 >SB_16449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 41.1 bits (92), Expect = 3e-04 Identities = 18/47 (38%), Positives = 28/47 (59%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q ELE+ F S Y + + ELA+ + L E +V++WFQN Sbjct: 89 RTTFTTFQLHELERAFEKSHYPDVYTREELALKISLPEVRVQVWFQN 135 >SB_174| Best HMM Match : Homeobox (HMM E-Value=1.9e-19) Length = 149 Score = 41.1 bits (92), Expect = 3e-04 Identities = 17/49 (34%), Positives = 30/49 (61%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + R +S Q + LE+ F Y R+ I+ + +LA L + E ++++WFQN Sbjct: 4 RQRTFFSKEQTVILEEAFQYERFPGIQIREKLARELDIDESRIQVWFQN 52 >SB_39292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 40.7 bits (91), Expect = 4e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q ELE+ F + Y I + ELA LGLSE +V++WF N Sbjct: 552 RTRFTVSQTDELERAFRKTHYPDIYAREELAQRLGLSEARVQVWFSN 598 Score = 30.7 bits (66), Expect = 0.41 Identities = 17/49 (34%), Positives = 28/49 (57%) Query: 5 TRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVK 53 TR + + R ++ Q ELEK F ++Y + + ELA L L+E +V+ Sbjct: 18 TRKQRRSRTKFTSKQVDELEKAFLKTQYPDVYTREELAQRLNLTEARVQ 66 >SB_11048| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 40.7 bits (91), Expect = 4e-04 Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S ++ + R +S Q + LE F Y R+ I+ + +LA L + E ++++WFQN Sbjct: 23 SNPRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQVWFQN 79 >SB_49340| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 40.7 bits (91), Expect = 4e-04 Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S ++ + R +S Q + LE F Y R+ I+ + +LA L + E ++++WFQN Sbjct: 23 SNPRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQVWFQN 79 >SB_18861| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 40.7 bits (91), Expect = 4e-04 Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S ++ + R +S Q + LE F Y R+ I+ + +LA L + E ++++WFQN Sbjct: 23 SNPRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQVWFQN 79 >SB_17558| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 40.7 bits (91), Expect = 4e-04 Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S ++ + R +S Q + LE F Y R+ I+ + +LA L + E ++++WFQN Sbjct: 23 SNPRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQVWFQN 79 >SB_16448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 40.7 bits (91), Expect = 4e-04 Identities = 18/49 (36%), Positives = 31/49 (63%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++R ++ Q ELE+ F + Y + + ELA +GL+E +V++WFQN Sbjct: 92 RHRTRFTPAQLNELERCFARTHYPDVFMREELAARIGLTESRVQVWFQN 140 >SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2103 Score = 40.3 bits (90), Expect = 5e-04 Identities = 17/47 (36%), Positives = 29/47 (61%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R + Q ELEK +H+++Y + + LA+ L L E ++++WFQN Sbjct: 324 RTNFDSWQLEELEKIYHHNQYPDVFTREALALKLDLLESRIQVWFQN 370 >SB_34509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 40.3 bits (90), Expect = 5e-04 Identities = 16/53 (30%), Positives = 32/53 (60%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + K ++R ++++ Q LE F + Y + + ELA+ + L E +V++WF+N Sbjct: 72 KRKRRHRTIFTEEQLELLETTFQKTHYPDVLLREELAMKVDLKEERVEVWFKN 124 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 39.9 bits (89), Expect = 7e-04 Identities = 17/47 (36%), Positives = 30/47 (63%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R +S Q +LE+ F +Y++ + +AE+A + +++ QVK WFQN Sbjct: 83 RSFFSADQVNQLERVFTAQQYVSAKERAEIAETFNMTDDQVKNWFQN 129 >SB_50832| Best HMM Match : Homeobox (HMM E-Value=8.7e-23) Length = 285 Score = 39.5 bits (88), Expect = 9e-04 Identities = 18/55 (32%), Positives = 33/55 (60%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++R + R V++ Q +LE F + +Y++ + + E A SL L+ Q+K W+QN Sbjct: 200 ESRRFRRIRTVFTRDQLQKLEDRFKHDKYLSTQDRNEFARSLQLTPLQLKTWYQN 254 >SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 39.1 bits (87), Expect = 0.001 Identities = 17/55 (30%), Positives = 33/55 (60%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R + + R ++ Q +LE F +RY ++ + E+A+ L+E +V++WF+N Sbjct: 737 KKRKQRRQRTHFTSFQLQQLEGTFGRNRYPDMQMREEIALYTNLTEARVRVWFKN 791 Score = 33.5 bits (73), Expect = 0.058 Identities = 14/47 (29%), Positives = 26/47 (55%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R ++ Q LE+ F + Y + + +LAV L E ++++WF+N Sbjct: 1112 RTTFNQFQLDTLERAFSRTHYPDVLLREQLAVYTNLPESRIQVWFKN 1158 >SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 37.9 bits (84), Expect = 0.003 Identities = 16/56 (28%), Positives = 29/56 (51%) Query: 3 RKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + R + R ++ Q LEK F + Y + + +LA S L E ++++WF+N Sbjct: 62 KSRRGSRRTRTAFTHQQLTALEKVFSKTHYPDVEVREQLATSTNLQEARIQVWFKN 117 >SB_49289| Best HMM Match : Homeobox (HMM E-Value=6e-30) Length = 285 Score = 37.9 bits (84), Expect = 0.003 Identities = 18/44 (40%), Positives = 26/44 (59%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++ Q +LE+ F + Y + LA LGLSE +V+IWFQN Sbjct: 123 FTGDQLRDLERLFEQTHYPDAMTREGLAKKLGLSEARVQIWFQN 166 >SB_18528| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 390 Score = 37.5 bits (83), Expect = 0.004 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S K R K R V+ +LE+ F RYI+ ++ LA L ++E QVK WF N Sbjct: 77 SSKARNK---RPVFHPDVVAQLEQVFDERRYISADQRFALAKELNMTEEQVKSWFHN 130 >SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28) Length = 246 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/53 (32%), Positives = 32/53 (60%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R + + R ++ +Q LE+ F +RY I + E+A+ + L E +V++WF+N Sbjct: 56 RKQRRERTTFTKNQLEILEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKN 108 >SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 37.5 bits (83), Expect = 0.004 Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 4 KTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K R + R +++ Q LE + RY++ + LA +L ++E QV+ WFQN Sbjct: 149 KNRANPRTRTHFTERQLKYLETYYSNGRYLSRDERTVLAQALEMTELQVRNWFQN 203 >SB_11047| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) Length = 193 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S ++ + +S Q + LE F Y R+ I+ + +L L + E ++++WFQN Sbjct: 23 SNPRKSHRRQNTFFSKEQTVILEGAFQYERFPGIQIREKLVRELDIDESRIQVWFQN 79 >SB_15284| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) Length = 159 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S ++ + +S Q + LE F Y R+ I+ + +L L + E ++++WFQN Sbjct: 23 SNPRKSHRRQNTFFSKEQTVILEGAFQYERFPGIQIREKLVRELDIDESRIQVWFQN 79 >SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) Length = 216 Score = 36.7 bits (81), Expect = 0.006 Identities = 16/44 (36%), Positives = 25/44 (56%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 Y RL E F Y R+ I+ + +LA L + E ++++WFQN Sbjct: 59 YFTSPRLATEGAFQYERFPGIQIREKLARELDIDESRIQVWFQN 102 >SB_34025| Best HMM Match : Homeobox (HMM E-Value=1.1e-35) Length = 460 Score = 35.9 bits (79), Expect = 0.011 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query: 4 KTR-TKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 KTR ++ + R V+ LE+ F RYI ++ LA + ++E Q+K WF N Sbjct: 124 KTRNSQPRKRPVFHPDVVARLEQFFAKRRYINAEQRYALAKEINMTEEQIKSWFHN 179 Score = 33.9 bits (74), Expect = 0.044 Identities = 16/52 (30%), Positives = 27/52 (51%) Query: 7 TKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++ + R V+ LE+ F RYI ++ ELA + ++E Q+K W N Sbjct: 319 SQPRKRPVFHPDVVARLEQFFAKRRYINAEQQYELAKEINMTEEQIKSWLHN 370 >SB_22965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 35.5 bits (78), Expect = 0.014 Identities = 16/53 (30%), Positives = 31/53 (58%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKI 54 S K K ++R +++++Q ELEK F S Y + + L++ + L E +++I Sbjct: 90 SSKKAKKRRHRTIFTNYQLEELEKAFKESHYPDVYARENLSLKIDLPEDRIQI 142 >SB_5629| Best HMM Match : PAX (HMM E-Value=0) Length = 383 Score = 35.1 bits (77), Expect = 0.019 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 6/58 (10%) Query: 1 MSRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 ++R+TRT+ ++ Q L+ EF + Y T+ + ELA L + E +V++WF N Sbjct: 276 LTRRTRTR------FTSQQLHVLQSEFTRNPYPTLEERKELARYLCVCESRVQVWFSN 327 >SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 34.7 bits (76), Expect = 0.025 Identities = 16/37 (43%), Positives = 23/37 (62%) Query: 22 ELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +LE F + Y T + LAV LGL + +V++WFQN Sbjct: 546 KLESAFAINPYPTCLYEKALAVRLGLRDSRVQVWFQN 582 Score = 30.3 bits (65), Expect = 0.54 Identities = 17/43 (39%), Positives = 22/43 (51%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKI 54 R Y Q ELE F + Y T K LAV LGL + +V++ Sbjct: 419 RTTYKRWQIEELESAFSINPYPTSLHKKALAVRLGLRDSRVQV 461 >SB_45591| Best HMM Match : Homeobox (HMM E-Value=7.3e-18) Length = 293 Score = 33.9 bits (74), Expect = 0.044 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 S + K K R + Q++ LE + +Y TI + L S LSE ++++WFQN Sbjct: 163 SDRADIKRKRRNLTKRQQKI-LETAYSTIKYPTIEDRQRLETSTQLSEDRIQVWFQN 218 >SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 824 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/53 (32%), Positives = 29/53 (54%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + K ++R +S Q L+ F Y++ + LA +L ++E QV+ WFQN Sbjct: 491 KKKKRHRSHFSQLQLQYLDAIFARQHYLSRDERTVLAGALDMTELQVRNWFQN 543 >SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 33.1 bits (72), Expect = 0.077 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 5 TRTKDKYRVVYSDHQRLE-LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 +R K + HQ+L+ LE F + Y + + +LA + + E ++++WF+N Sbjct: 52 SRAKHRRTRTAFTHQQLQILESTFSKTHYPDVVMREQLAAYINIPESRIQVWFKN 106 >SB_14196| Best HMM Match : FG-GAP (HMM E-Value=0) Length = 693 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/53 (32%), Positives = 29/53 (54%) Query: 6 RTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + K ++R +S Q L+ F Y++ + LA +L ++E QV+ WFQN Sbjct: 24 KKKKRHRSHFSQLQLQYLDAIFARQHYLSRDERTVLAGALDMTELQVRNWFQN 76 >SB_54939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 31.9 bits (69), Expect = 0.18 Identities = 13/49 (26%), Positives = 27/49 (55%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + R ++ +Q LE F + Y + + +LA + L E ++++WF+N Sbjct: 151 RMRTCFTPYQLQVLENTFCNTHYPDVMLREQLASYVNLPEARIQVWFKN 199 >SB_54937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 30.3 bits (65), Expect = 0.54 Identities = 16/52 (30%), Positives = 27/52 (51%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVK 53 + + R + R ++ Q LEKEF S Y + + ELA + +SE +V+ Sbjct: 103 TNQKRKLRRNRTTFTPDQLEMLEKEFEKSHYPDVATREELANKIDMSEARVQ 154 >SB_48109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 30.3 bits (65), Expect = 0.54 Identities = 17/44 (38%), Positives = 22/44 (50%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + + R L K + S Y T R K ELA L+ QV WF+N Sbjct: 186 FKEKSRSILNKAYVDSPYPTPREKHELAKMTDLTVTQVSNWFKN 229 >SB_28488| Best HMM Match : PAX (HMM E-Value=0) Length = 551 Score = 30.3 bits (65), Expect = 0.54 Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVK 53 R ++ Q ELE+ F + Y I + ELA LGLSE +V+ Sbjct: 510 RTRFTVSQTDELERAFRKTHYPDIYAREELAQRLGLSEARVQ 551 >SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/52 (26%), Positives = 29/52 (55%) Query: 2 SRKTRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVK 53 S++++ + R ++D Q +LEK F + Y + + LA + LSE +++ Sbjct: 322 SQRSKMSRRQRTNFTDEQIEKLEKVFEKTHYPDVFTREGLAQQVNLSEARIQ 373 >SB_5495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 28.3 bits (60), Expect = 2.2 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Query: 2 SRKTRTKDKYR---VVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKI 54 SRK K + R Y+D Q +E+ F R+ I + L+ LG+ E ++++ Sbjct: 12 SRKNTAKARQRRRRTFYTDSQLRRMEEVFERDRFPGIAARESLSEELGIKEDRLQV 67 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/49 (24%), Positives = 25/49 (51%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + R + HQ ++ F + + +L+ GL++R +++WFQN Sbjct: 422 RVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQN 470 >SB_51509| Best HMM Match : Homeobox (HMM E-Value=2.3e-09) Length = 53 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/42 (30%), Positives = 24/42 (57%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVK 53 R + Q ELEK +H+++Y + + LA+ L L E +++ Sbjct: 12 RTNFDSWQLEELEKIYHHNQYPDVFTREALALKLDLLESRIQ 53 >SB_14839| Best HMM Match : Homeobox (HMM E-Value=4.3e-13) Length = 319 Score = 27.9 bits (59), Expect = 2.9 Identities = 16/47 (34%), Positives = 24/47 (51%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R +SD Q L+ F ++ ++ EL +L L Q +IWFQN Sbjct: 147 RTRFSDLQLAALDMLFTKTQNPSVEVLEELCNTLHLELAQAQIWFQN 193 >SB_12335| Best HMM Match : Pou (HMM E-Value=0) Length = 401 Score = 27.5 bits (58), Expect = 3.8 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 8 KDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 K K R + + + LE F + + LA SLGL V++WF N Sbjct: 319 KRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCN 369 >SB_10703| Best HMM Match : Homeobox (HMM E-Value=4.6e-08) Length = 531 Score = 27.5 bits (58), Expect = 3.8 Identities = 17/40 (42%), Positives = 22/40 (55%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQ 51 R V+S Q LE+ F S+YI ++ LA L LSE Q Sbjct: 471 RTVFSAQQLQVLERVFAGSQYIVGSQRKFLASQLRLSETQ 510 >SB_53272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 27.5 bits (58), Expect = 3.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Query: 23 LEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 LE F S T + + LA +LGL + V++WF N Sbjct: 303 LENHFCKSPKPTAQEISALAENLGLDKEVVRVWFCN 338 >SB_31091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 27.5 bits (58), Expect = 3.8 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 12 RVVYSDHQRLELEKEF-HYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 R S+ + +E F + SR+IT +A LA L L E V+ +F+N Sbjct: 543 RTFISNMAKKTMEHYFVNTSRFITQDTRAVLAKQLNLPEETVQFYFKN 590 >SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/18 (55%), Positives = 15/18 (83%) Query: 41 LAVSLGLSERQVKIWFQN 58 LA+ L L+E +V++WFQN Sbjct: 5 LAMRLDLTEARVQVWFQN 22 >SB_37035| Best HMM Match : Homeobox (HMM E-Value=9.6e-09) Length = 243 Score = 27.1 bits (57), Expect = 5.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + + R L + + Y +K ELA + GL+ QV WF+N Sbjct: 136 FKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKN 179 >SB_4115| Best HMM Match : Homeobox (HMM E-Value=9.4e-08) Length = 267 Score = 27.1 bits (57), Expect = 5.1 Identities = 13/54 (24%), Positives = 26/54 (48%) Query: 5 TRTKDKYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 T T + R +S + L +E+ + + ++ LA L E++++ WF N Sbjct: 49 TPTSVRVRKFFSAADKSRLLQEYESNIHPNKEQRTRLAQELRTKEKRIRTWFAN 102 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 26.6 bits (56), Expect = 6.7 Identities = 12/44 (27%), Positives = 23/44 (52%) Query: 15 YSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + + R L+ + ++Y T + K +A L+ +QV WF+N Sbjct: 141 FKEKARAALKDCYEQNKYPTPQEKRLIAKQTNLTLKQVSNWFKN 184 >SB_5296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/43 (25%), Positives = 26/43 (60%) Query: 12 RVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKI 54 R ++ +Q +LE + ++Y ++ + LA LG++E +V++ Sbjct: 224 RTKFTAYQLEQLEDAYQKAKYPDVQARETLAQRLGVAESRVQV 266 >SB_1883| Best HMM Match : LIM (HMM E-Value=2.20004e-42) Length = 328 Score = 26.6 bits (56), Expect = 6.7 Identities = 13/49 (26%), Positives = 24/49 (48%) Query: 10 KYRVVYSDHQRLELEKEFHYSRYITIRRKAELAVSLGLSERQVKIWFQN 58 + R +++ Q L+ F+ + +A GLS+R ++WFQN Sbjct: 256 RVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQN 304 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.320 0.134 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,933,355 Number of Sequences: 59808 Number of extensions: 50623 Number of successful extensions: 249 Number of sequences better than 10.0: 117 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 125 Number of HSP's gapped (non-prelim): 126 length of query: 132 length of database: 16,821,457 effective HSP length: 75 effective length of query: 57 effective length of database: 12,335,857 effective search space: 703143849 effective search space used: 703143849 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -