Silkworm BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001179-TA|BGIBMGA001179-PA|undefined
         (117 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   6.9  

>SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4247

 Score = 26.2 bits (55), Expect = 6.9
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 30 LEEQQWCAWNGAPATGEWTPDPHHF-PKREPGEREIADMPS 69
          L+E+    +NG P +  +TP  H F    E G  E+ D+ S
Sbjct: 8  LQEEGCLQFNGRPTSISYTPTSHCFVATLEDGSVEVLDVSS 48


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.315    0.134    0.468 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,580,049
Number of Sequences: 59808
Number of extensions: 107772
Number of successful extensions: 115
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 115
Number of HSP's gapped (non-prelim): 1
length of query: 117
length of database: 16,821,457
effective HSP length: 73
effective length of query: 44
effective length of database: 12,455,473
effective search space: 548040812
effective search space used: 548040812
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 54 (25.8 bits)