BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001177-TA|BGIBMGA001177-PA|IPR000595|Cyclic nucleotide-binding (508 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 24 2.2 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 8.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 8.8 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 24.2 bits (50), Expect = 2.2 Identities = 12/53 (22%), Positives = 26/53 (49%) Query: 285 GAYNNRRESRDSVESTSQRKSIERKRTESILKNSSLSKQSKHSEGNKGESVQI 337 G N ++ + +T+Q K+ + E KN+ +K+S+ + K + + I Sbjct: 113 GTNNGTNKNMRRLSTTTQNKNDDPSYWEKRRKNNEAAKRSRDARRAKEDEIAI 165 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/34 (26%), Positives = 20/34 (58%) Query: 447 QHYLDKKIPTKKDLFKQFVEDRRWQEFRDQMVDD 480 ++YL+KK+ + F + V R + F++ +V + Sbjct: 237 RYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPE 270 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/34 (26%), Positives = 20/34 (58%) Query: 447 QHYLDKKIPTKKDLFKQFVEDRRWQEFRDQMVDD 480 ++YL+KK+ + F + V R + F++ +V + Sbjct: 237 RYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPE 270 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,216 Number of Sequences: 317 Number of extensions: 4673 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 3 length of query: 508 length of database: 114,650 effective HSP length: 60 effective length of query: 448 effective length of database: 95,630 effective search space: 42842240 effective search space used: 42842240 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -