BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001176-TA|BGIBMGA001176-PA|undefined (169 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 0.58 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 0.58 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.8 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.58 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 95 QLNSEQKSL--INHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTA 150 QL Q+SL +N ES EK +P + + V + +EG + +KN+ Y A Sbjct: 1101 QLRKIQESLRDLNRKIESL-EKMQYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYMEA 1157 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.58 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 95 QLNSEQKSL--INHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTA 150 QL Q+SL +N ES EK +P + + V + +EG + +KN+ Y A Sbjct: 1101 QLRKIQESLRDLNRKIESL-EKMQYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYMEA 1157 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Query: 79 ELTPESTKEQNSAGLNQLNSEQKSLINHYNESYK 112 EL ++ K + + N +SE+KS I H ++++K Sbjct: 242 ELIRQTHKSPSHSVDNSNSSEKKSSIQHGDDAHK 275 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.131 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,191 Number of Sequences: 317 Number of extensions: 1615 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 169 length of database: 114,650 effective HSP length: 53 effective length of query: 116 effective length of database: 97,849 effective search space: 11350484 effective search space used: 11350484 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -