BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001176-TA|BGIBMGA001176-PA|undefined (169 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC093660-1|AAH93660.1| 931|Homo sapiens transient receptor pote... 31 2.0 BC093658-1|AAH93658.1| 931|Homo sapiens transient receptor pote... 31 2.0 AJ271068-1|CAC01686.1| 876|Homo sapiens transient receptor pote... 31 2.0 AJ271067-1|CAC01685.1| 815|Homo sapiens transient receptor pote... 31 2.0 AJ271066-1|CAC01684.1| 931|Homo sapiens transient receptor pote... 31 2.0 AJ006276-1|CAA06943.1| 931|Homo sapiens transient receptor pote... 31 2.0 AF080394-1|AAC63289.2| 931|Homo sapiens transient receptor pote... 31 2.0 BC047879-1|AAH47879.1| 577|Homo sapiens SHQ1 homolog (S. cerevi... 30 3.5 BC039830-1|AAH39830.1| 577|Homo sapiens SHQ1 homolog (S. cerevi... 30 3.5 BC032671-1|AAH32671.1| 577|Homo sapiens SHQ1 homolog (S. cerevi... 30 3.5 BC025270-1|AAH25270.1| 577|Homo sapiens SHQ1 homolog (S. cerevi... 30 3.5 BC017274-1|AAH17274.1| 577|Homo sapiens SHQ1 homolog (S. cerevi... 30 3.5 BC017204-1|AAH17204.1| 577|Homo sapiens SHQ1 homolog (S. cerevi... 30 3.5 AK001401-1|BAA91669.1| 519|Homo sapiens protein ( Homo sapiens ... 30 3.5 AJ389929-1|CAB57376.1| 110|Homo sapiens immunoglobulin heavy ch... 30 4.6 AF250287-1|AAF81273.1| 430|Homo sapiens cervical SH3P7 protein. 30 4.6 AF151364-1|AAG13120.1| 430|Homo sapiens mucin-associated protei... 30 4.6 >BC093660-1|AAH93660.1| 931|Homo sapiens transient receptor potential cation channel, subfamily C, member 6 protein. Length = 931 Score = 31.1 bits (67), Expect = 2.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 98 SEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKI 157 SE KS++ +YN + E G+ V +L L I + NSSFQE + + K Sbjct: 686 SEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNML-IAMINSSFQEIEDDADVEWKF 744 Query: 158 CRYRIY 163 R +++ Sbjct: 745 ARAKLW 750 >BC093658-1|AAH93658.1| 931|Homo sapiens transient receptor potential cation channel, subfamily C, member 6 protein. Length = 931 Score = 31.1 bits (67), Expect = 2.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 98 SEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKI 157 SE KS++ +YN + E G+ V +L L I + NSSFQE + + K Sbjct: 686 SEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNML-IAMINSSFQEIEDDADVEWKF 744 Query: 158 CRYRIY 163 R +++ Sbjct: 745 ARAKLW 750 >AJ271068-1|CAC01686.1| 876|Homo sapiens transient receptor potential channel 6, variant delta377-431 protein. Length = 876 Score = 31.1 bits (67), Expect = 2.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 98 SEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKI 157 SE KS++ +YN + E G+ V +L L I + NSSFQE + + K Sbjct: 631 SEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNML-IAMINSSFQEIEDDADVEWKF 689 Query: 158 CRYRIY 163 R +++ Sbjct: 690 ARAKLW 695 >AJ271067-1|CAC01685.1| 815|Homo sapiens transient receptor potential channel 6, variant delta316-431 protein. Length = 815 Score = 31.1 bits (67), Expect = 2.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 98 SEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKI 157 SE KS++ +YN + E G+ V +L L I + NSSFQE + + K Sbjct: 570 SEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNML-IAMINSSFQEIEDDADVEWKF 628 Query: 158 CRYRIY 163 R +++ Sbjct: 629 ARAKLW 634 >AJ271066-1|CAC01684.1| 931|Homo sapiens transient receptor potential channel 6 protein. Length = 931 Score = 31.1 bits (67), Expect = 2.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 98 SEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKI 157 SE KS++ +YN + E G+ V +L L I + NSSFQE + + K Sbjct: 686 SEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNML-IAMINSSFQEIEDDADVEWKF 744 Query: 158 CRYRIY 163 R +++ Sbjct: 745 ARAKLW 750 >AJ006276-1|CAA06943.1| 931|Homo sapiens transient receptor potential protein protein. Length = 931 Score = 31.1 bits (67), Expect = 2.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 98 SEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKI 157 SE KS++ +YN + E G+ V +L L I + NSSFQE + + K Sbjct: 686 SEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNML-IAMINSSFQEIEDDADVEWKF 744 Query: 158 CRYRIY 163 R +++ Sbjct: 745 ARAKLW 750 >AF080394-1|AAC63289.2| 931|Homo sapiens transient receptor potential protein 6 protein. Length = 931 Score = 31.1 bits (67), Expect = 2.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 98 SEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKI 157 SE KS++ +YN + E G+ V +L L I + NSSFQE + + K Sbjct: 686 SEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLNML-IAMINSSFQEIEDDADVEWKF 744 Query: 158 CRYRIY 163 R +++ Sbjct: 745 ARAKLW 750 >BC047879-1|AAH47879.1| 577|Homo sapiens SHQ1 homolog (S. cerevisiae) protein. Length = 577 Score = 30.3 bits (65), Expect = 3.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 49 DNYLEELSTAEK-NKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHY 107 D+YL + E ++ K++P K S+M +S +++N A L + E+K + + Sbjct: 197 DHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKF 256 Query: 108 -NESY 111 N+SY Sbjct: 257 VNKSY 261 >BC039830-1|AAH39830.1| 577|Homo sapiens SHQ1 homolog (S. cerevisiae) protein. Length = 577 Score = 30.3 bits (65), Expect = 3.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 49 DNYLEELSTAEK-NKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHY 107 D+YL + E ++ K++P K S+M +S +++N A L + E+K + + Sbjct: 197 DHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKF 256 Query: 108 -NESY 111 N+SY Sbjct: 257 VNKSY 261 >BC032671-1|AAH32671.1| 577|Homo sapiens SHQ1 homolog (S. cerevisiae) protein. Length = 577 Score = 30.3 bits (65), Expect = 3.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 49 DNYLEELSTAEK-NKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHY 107 D+YL + E ++ K++P K S+M +S +++N A L + E+K + + Sbjct: 197 DHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKF 256 Query: 108 -NESY 111 N+SY Sbjct: 257 VNKSY 261 >BC025270-1|AAH25270.1| 577|Homo sapiens SHQ1 homolog (S. cerevisiae) protein. Length = 577 Score = 30.3 bits (65), Expect = 3.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 49 DNYLEELSTAEK-NKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHY 107 D+YL + E ++ K++P K S+M +S +++N A L + E+K + + Sbjct: 197 DHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKF 256 Query: 108 -NESY 111 N+SY Sbjct: 257 VNKSY 261 >BC017274-1|AAH17274.1| 577|Homo sapiens SHQ1 homolog (S. cerevisiae) protein. Length = 577 Score = 30.3 bits (65), Expect = 3.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 49 DNYLEELSTAEK-NKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHY 107 D+YL + E ++ K++P K S+M +S +++N A L + E+K + + Sbjct: 197 DHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKF 256 Query: 108 -NESY 111 N+SY Sbjct: 257 VNKSY 261 >BC017204-1|AAH17204.1| 577|Homo sapiens SHQ1 homolog (S. cerevisiae) protein. Length = 577 Score = 30.3 bits (65), Expect = 3.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 49 DNYLEELSTAEK-NKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHY 107 D+YL + E ++ K++P K S+M +S +++N A L + E+K + + Sbjct: 197 DHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKF 256 Query: 108 -NESY 111 N+SY Sbjct: 257 VNKSY 261 >AK001401-1|BAA91669.1| 519|Homo sapiens protein ( Homo sapiens cDNA FLJ10539 fis, clone NT2RP2001218. ). Length = 519 Score = 30.3 bits (65), Expect = 3.5 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query: 49 DNYLEELSTAEK-NKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHY 107 D+YL + E ++ K++P K S+M +S +++N A L + E+K + + Sbjct: 139 DHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKF 198 Query: 108 -NESY 111 N+SY Sbjct: 199 VNKSY 203 >AJ389929-1|CAB57376.1| 110|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 110 Score = 29.9 bits (64), Expect = 4.6 Identities = 15/51 (29%), Positives = 23/51 (45%) Query: 3 WQDGGIYLCGLTIRLTNARWSSQYAAAIEVGKKRPFNNSTELCAAFDNYLE 53 W D Y L RLT ++ +S + + P + +T CA DN L+ Sbjct: 55 WDDDKYYSTSLKTRLTISKDTSXNQVVLTMTNMDPVDTATYFCARTDNSLD 105 >AF250287-1|AAF81273.1| 430|Homo sapiens cervical SH3P7 protein. Length = 430 Score = 29.9 bits (64), Expect = 4.6 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 76 QMGELTPESTKEQNSAGLNQLNSEQKSLINHYNESYKEK 114 Q GE +P+ST EQ +++ +EQ+S + H E +K+K Sbjct: 227 QGGEASPQSTWEQQQEVVSRNRNEQESAV-HPREIFKQK 264 >AF151364-1|AAG13120.1| 430|Homo sapiens mucin-associated protein protein. Length = 430 Score = 29.9 bits (64), Expect = 4.6 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 76 QMGELTPESTKEQNSAGLNQLNSEQKSLINHYNESYKEK 114 Q GE +P+ST EQ +++ +EQ+S + H E +K+K Sbjct: 227 QGGEASPQSTWEQQQEVVSRNRNEQESAV-HPREIFKQK 264 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.316 0.131 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,592,248 Number of Sequences: 224733 Number of extensions: 924223 Number of successful extensions: 2826 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 16 Number of HSP's that attempted gapping in prelim test: 2825 Number of HSP's gapped (non-prelim): 17 length of query: 169 length of database: 73,234,838 effective HSP length: 85 effective length of query: 84 effective length of database: 54,132,533 effective search space: 4547132772 effective search space used: 4547132772 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -