BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001175-TA|BGIBMGA001175-PA|IPR008383|Apoptosis inhibitory 5 (468 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.5 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 23 4.6 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 23 4.6 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 23 4.6 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 23 4.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 6.1 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 23 6.1 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 46 LASQFIAKFFNSFPTLSEQAIEAQFDLC 73 L QF+A F+ F T++ + +LC Sbjct: 1338 LVIQFVAMLFHRFGTIAHILASTELNLC 1365 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 46 LASQFIAKFFNSFPTLSEQAIEAQFDLC 73 L QF+A F+ F T++ + +LC Sbjct: 1338 LVIQFVAMLFHRFGTIAHILASTELNLC 1365 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 46 LASQFIAKFFNSFPTLSEQAIEAQFDLC 73 L QF+A F+ F T++ + +LC Sbjct: 1338 LVIQFVAMLFHRFGTIAHILASTELNLC 1365 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 46 LASQFIAKFFNSFPTLSEQAIEAQFDLC 73 L QF+A F+ F T++ + +LC Sbjct: 1338 LVIQFVAMLFHRFGTIAHILASTELNLC 1365 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.0 bits (47), Expect = 4.6 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 9 LYKNYDILAAAKDEISQHEKEYLEILAAVKGSDKE-KRLASQFIAKFF 55 LY NY + +DE+SQ ++Y L K S K + L + F + F Sbjct: 352 LYYNYTVDRDLQDEVSQKIRKY--YLGEKKLSKKTFRELVAMFSDRIF 397 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.0 bits (47), Expect = 4.6 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 9 LYKNYDILAAAKDEISQHEKEYLEILAAVKGSDKE-KRLASQFIAKFF 55 LY NY + +DE+SQ ++Y L K S K + L + F + F Sbjct: 352 LYYNYTVDRDLQDEVSQKIRKY--YLGEKKLSKKTFRELVAMFSDRIF 397 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.0 bits (47), Expect = 4.6 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 9 LYKNYDILAAAKDEISQHEKEYLEILAAVKGSDKE-KRLASQFIAKFF 55 LY NY + +DE+SQ ++Y L K S K + L + F + F Sbjct: 352 LYYNYTVDRDLQDEVSQKIRKY--YLGEKKLSKKTFRELVTMFSDRIF 397 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.0 bits (47), Expect = 4.6 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 9 LYKNYDILAAAKDEISQHEKEYLEILAAVKGSDKEKR-LASQFIAKFF 55 LY NY + +DE+SQ ++Y L K S K R L + F + F Sbjct: 352 LYYNYTVDRDLQDEVSQKIRKY--YLGEKKLSKKTFRDLVAMFSDRIF 397 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 6.1 Identities = 10/29 (34%), Positives = 12/29 (41%) Query: 252 TQHAVPLFSPQVDSTQFINFFCDHVLPKW 280 T H PL+SP DS +H W Sbjct: 289 TGHNAPLYSPSSDSQYQKQLNVEHAANLW 317 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 9 LYKNYDILAAAKDEISQHEKEY 30 LY NY + +DE+SQ ++Y Sbjct: 352 LYYNYTVDRDLQDEVSQKIRKY 373 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.132 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,833 Number of Sequences: 317 Number of extensions: 3659 Number of successful extensions: 29 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 14 length of query: 468 length of database: 114,650 effective HSP length: 59 effective length of query: 409 effective length of database: 95,947 effective search space: 39242323 effective search space used: 39242323 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -