BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001172-TA|BGIBMGA001172-PA|IPR001206|Diacylglycerol kinase, catalytic region, IPR002219|Protein kinase C, phorbol ester/diacylglycerol binding (269 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 24 1.6 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 43 VTHHHWVHRRSEKGKCKACGKSLQAKLSFS 72 +T H+ H + +C+ C KS K + S Sbjct: 107 LTRHYRTHTGEKPYQCEYCSKSFSVKENLS 136 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 4/19 (21%) Query: 49 VHRRSEKGK----CKACGK 63 +H R+ G+ CKACGK Sbjct: 193 IHMRTHTGEKPYVCKACGK 211 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.138 0.447 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,260 Number of Sequences: 429 Number of extensions: 3240 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 269 length of database: 140,377 effective HSP length: 57 effective length of query: 212 effective length of database: 115,924 effective search space: 24575888 effective search space used: 24575888 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -