BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001171-TA|BGIBMGA001171-PA|undefined (227 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 23 9.8 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 9.8 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 22.6 bits (46), Expect = 9.8 Identities = 15/49 (30%), Positives = 19/49 (38%) Query: 71 ELQPPSDEPPILPQRRRSISRQEAFFVEPTGSSLENVRASEEGVASAAR 119 EL PS P I ++ E FV P S+E +AAR Sbjct: 218 ELPRPSSPPAIRRSGTLEVTFSERTFVTPKRESMEQAEQEWTLKQAAAR 266 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 151 GARAEQLNGSANSLTVPGTGLRSRSVD 177 GA A +L+G+ PG G ++R D Sbjct: 214 GAPASRLDGNVQVREAPGPGEKARRSD 240 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.129 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,186 Number of Sequences: 2123 Number of extensions: 3992 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 227 length of database: 516,269 effective HSP length: 62 effective length of query: 165 effective length of database: 384,643 effective search space: 63466095 effective search space used: 63466095 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -