BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001171-TA|BGIBMGA001171-PA|undefined (227 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY393685-1|AAR02558.1| 150|Homo sapiens immunoglobulin heavy ch... 33 1.1 >AY393685-1|AAR02558.1| 150|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 150 Score = 32.7 bits (71), Expect = 1.1 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 2/98 (2%) Query: 96 FVEPTGSSLENVRASEEGVASAARDSLVHDIYLAVPELKRDRAASVDSCFSKVSGGARAE 155 ++ P ++ + + G A+ RD+ V +Y+ + L+ D A V C KV G +R Sbjct: 46 YINPNNGGTDSAQKFQ-GRATMTRDTSVSSVYMELRRLRSDDMA-VYYCAGKVVGTSRPF 103 Query: 156 QLNGSANSLTVPGTGLRSRSVDIVLPTAEQSRYKALAL 193 G +TV + SV + P+++ + AL Sbjct: 104 DHWGQGTLVTVSTASTKGPSVFPLAPSSKSTSGGTAAL 141 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.314 0.129 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,170,873 Number of Sequences: 224733 Number of extensions: 660363 Number of successful extensions: 1718 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1718 Number of HSP's gapped (non-prelim): 1 length of query: 227 length of database: 73,234,838 effective HSP length: 87 effective length of query: 140 effective length of database: 53,683,067 effective search space: 7515629380 effective search space used: 7515629380 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 64 (29.9 bits)
- SilkBase 1999-2023 -