BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001170-TA|BGIBMGA001170-PA|undefined (115 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 1.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 3.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 3.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 3.1 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 20 7.1 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 20 7.1 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 1.8 Identities = 15/40 (37%), Positives = 18/40 (45%) Query: 44 PQQASIAASTGPSQPTHCASWSYGTHLHCLIAQHSSSVST 83 PQ A +ST S PT S S T+ + SSV T Sbjct: 71 PQGAPSPSSTPSSLPTQRTSTSNPTYSSRSVMTSCSSVPT 110 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 3.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 42 VVPQQASIAASTGPSQPTHCASWSYG 67 V+P + A+S G P H +S+ G Sbjct: 106 VLPGNYANASSVGSRNPIHTSSYMTG 131 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 3.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 42 VVPQQASIAASTGPSQPTHCASWSYG 67 V+P + A+S G P H +S+ G Sbjct: 339 VLPGNYANASSVGSRNPIHTSSYMTG 364 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 3.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 42 VVPQQASIAASTGPSQPTHCASWSYG 67 V+P + A+S G P H +S+ G Sbjct: 339 VLPGNYANASSVGSRNPIHTSSYMTG 364 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 19.8 bits (39), Expect = 7.1 Identities = 8/25 (32%), Positives = 15/25 (60%) Query: 19 TAHQELRLPQSPRILADKSTSLTVV 43 T HQ L+ R+L+++ T T++ Sbjct: 672 TDHQALKFLSRCRLLSERLTRWTLI 696 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 19.8 bits (39), Expect = 7.1 Identities = 9/34 (26%), Positives = 17/34 (50%) Query: 15 DVQGTAHQELRLPQSPRILADKSTSLTVVPQQAS 48 D QG H++ LP + +A + V+ +A+ Sbjct: 629 DRQGLLHRQFNLPPAKDTIAVPNNGYVVLRLRAN 662 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.121 0.342 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,913 Number of Sequences: 317 Number of extensions: 961 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 115 length of database: 114,650 effective HSP length: 49 effective length of query: 66 effective length of database: 99,117 effective search space: 6541722 effective search space used: 6541722 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.4 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -