BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001169-TA|BGIBMGA001169-PA|undefined (359 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26417| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-21) 31 1.4 SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 >SB_26417| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-21) Length = 285 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/45 (35%), Positives = 26/45 (57%) Query: 226 FAMKAYKEGYPFNFVEGEMWEKSPFTLWDFMQQRKRWIQGILLVV 270 F + YK G VE + E+S ++D +Q+RKR ++ +L VV Sbjct: 151 FTVTFYKIGRKLRGVEKRLLERSRHDIFDVVQKRKRVLRVLLAVV 195 >SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1169 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query: 261 RWIQGILLVVHSKEIPLVN--NVFLAISSYSWVTLPLSTSNVVLAALCPIPCP 311 RW+ +++V + +P+V+ A+ +PL TS+ ++ + P+PCP Sbjct: 54 RWLVQRVIIVQLEMLPVVDAQEAINALMEQRLKFVPLVTSHQMVPRVPPVPCP 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.327 0.142 0.453 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,924,006 Number of Sequences: 59808 Number of extensions: 431173 Number of successful extensions: 1005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1004 Number of HSP's gapped (non-prelim): 2 length of query: 359 length of database: 16,821,457 effective HSP length: 83 effective length of query: 276 effective length of database: 11,857,393 effective search space: 3272640468 effective search space used: 3272640468 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -