BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001164-TA|BGIBMGA001164-PA|IPR004272|Odorant binding protein, IPR013053|Hormone binding (248 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 3.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.1 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 31 FSNENLEQCIKEQIEKSLPEFTKGIPELDV 60 F NENL + +K+ + F G+ L V Sbjct: 455 FKNENLSEMVKQFLFTQKFTFVAGLATLSV 484 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 5.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 139 DALINCVNVDVEIESKLNQVKDNNGKDHLKLGTPSYKYK 177 DA+ V + ++ LN+V+ K HLK S K + Sbjct: 482 DAIEKPAPVKISVQEVLNRVRKPTKKLHLKNSPISKKVR 520 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.136 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,793 Number of Sequences: 317 Number of extensions: 2723 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 248 length of database: 114,650 effective HSP length: 55 effective length of query: 193 effective length of database: 97,215 effective search space: 18762495 effective search space used: 18762495 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -