BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001160-TA|BGIBMGA001160-PA|IPR003010|Nitrilase/cyanide
hydratase and apolipoprotein N-acyltransferase, IPR003694|NAD+
synthase
         (697 letters)
Database: tribolium 
           317 sequences; 114,650 total letters
Searching....................................................done
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
AF025669-1|AAB81523.1|  243|Tribolium castaneum GABA receptor su...    23   9.3  
>AF025669-1|AAB81523.1|  243|Tribolium castaneum GABA receptor
           subunit protein.
          Length = 243
 Score = 22.6 bits (46), Expect = 9.3
 Identities = 10/49 (20%), Positives = 25/49 (51%)
Query: 284 KNRSRCHLAASNKPFPRIFVDVSLSDDEDIHLTTNPPIQWHYLSPEEEI 332
           + +S  H+A ++  F R+    S++    + +T + P+   YL  + ++
Sbjct: 132 EKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYLPMDRQL 180
  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.136    0.425 
Gapped
Lambda     K      H
   0.279   0.0580    0.190 
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,426
Number of Sequences: 317
Number of extensions: 7050
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 697
length of database: 114,650
effective HSP length: 62
effective length of query: 635
effective length of database: 94,996
effective search space: 60322460
effective search space used: 60322460
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -