BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001159-TA|BGIBMGA001159-PA|IPR007261|Vacuolar protein sorting 36 (401 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 23 3.9 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 22 6.8 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 23.0 bits (47), Expect = 3.9 Identities = 7/19 (36%), Positives = 15/19 (78%) Query: 59 LVCLSLHLYYVFCLEEESG 77 ++ +SL +Y+++ + EESG Sbjct: 15 IIFVSLEIYHIYTVVEESG 33 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 22.2 bits (45), Expect = 6.8 Identities = 12/55 (21%), Positives = 26/55 (47%) Query: 176 RSIEEQHRATDQSISVAFQDLTKLMEKAKEMVSLSKNISTKIREKQGDISEDDTV 230 + ++++H+ ++ A Q L + +EKAK +S + I D +T+ Sbjct: 70 KMVKQKHKKDIRADKKALQKLRREVEKAKRDLSSVHKTTLTIENLLADYDFSETL 124 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,418 Number of Sequences: 317 Number of extensions: 3572 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 401 length of database: 114,650 effective HSP length: 58 effective length of query: 343 effective length of database: 96,264 effective search space: 33018552 effective search space used: 33018552 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -