GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001159-TA|BGIBMGA001159-PA|IPR007261|Vacuolar protein
sorting 36
         (401 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi...    27   1.2  

>AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing
           protein I protein.
          Length = 1340

 Score = 26.6 bits (56), Expect = 1.2
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 202 KAKEMVSLSKNISTKIREKQGDISEDDTVRFKSYLMSLGIDDP 244
           K  E+V LSK+IS  I+  +      DTV F+  L+   +  P
Sbjct: 110 KEAELVYLSKSISGLIQVDKPVFKPGDTVNFRVILLDTELKPP 152


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.137    0.397 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 380,932
Number of Sequences: 2123
Number of extensions: 15242
Number of successful extensions: 51
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 50
Number of HSP's gapped (non-prelim): 1
length of query: 401
length of database: 516,269
effective HSP length: 65
effective length of query: 336
effective length of database: 378,274
effective search space: 127100064
effective search space used: 127100064
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)