BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001159-TA|BGIBMGA001159-PA|IPR007261|Vacuolar protein sorting 36 (401 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 27 1.2 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 26.6 bits (56), Expect = 1.2 Identities = 15/43 (34%), Positives = 22/43 (51%) Query: 202 KAKEMVSLSKNISTKIREKQGDISEDDTVRFKSYLMSLGIDDP 244 K E+V LSK+IS I+ + DTV F+ L+ + P Sbjct: 110 KEAELVYLSKSISGLIQVDKPVFKPGDTVNFRVILLDTELKPP 152 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 380,932 Number of Sequences: 2123 Number of extensions: 15242 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 50 Number of HSP's gapped (non-prelim): 1 length of query: 401 length of database: 516,269 effective HSP length: 65 effective length of query: 336 effective length of database: 378,274 effective search space: 127100064 effective search space used: 127100064 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -